Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope mapping of Burkholderia pseudomallei serine metalloprotease: identification of serine protease epitope mimics.

    ID: 6441

    Description: epitope description:AHLHIPRWNLMS host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-serine protease Ab

    Publication: 15607634;

  2. Epitope mapping of Burkholderia pseudomallei serine metalloprotease: identification of serine protease epitope mimics.

    ID: 6443

    Description: epitope description:KTNNSYIPPLTW host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-serine protease Ab

    Publication: 15607634;

  3. Epitope mapping of Burkholderia pseudomallei serine metalloprotease: identification of serine protease epitope mimics.

    ID: 6444

    Description: epitope description:VAPSMAKSIPAK host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-serine protease Ab

    Publication: 15607634;

  4. Three-dimensional structures of the free and the antigen-complexed Fab from monoclonal anti-lysozyme antibody D44.1.

    ID: 6518

    Description: epitope description:Q59, R63, N64, T65, G67, Y71, D84, G85, R86, P88, S99, L102 antigen name:Gal d 4 host organism:Mus musculus BALB/c antibody name:D...

    Publication: 7966295;

  5. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6810

    Description: epitope description:MTEQQWNFAGIEAAASAIQG antigen name:6 kDa early secretory antigenic target host organism:Macaca mulatta antibody name:anti-ESAT Ab

    Publication: 14715573;

  6. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6813

    Description: epitope description:MTEQQWNFAGIEAAASAIQG antigen name:6 kDa early secretory antigenic target host organism:Macaca fascicularis antibody name:anti-ESAT...

    Publication: 14715573;

  7. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6851

    Description: epitope description:GKQSLTKLAAAWGGSGSEAYQGVQ antigen name:6 kDa early secretory antigenic target host organism:Macaca mulatta antibody name:anti-ESAT ...

    Publication: 14715573;

  8. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6856

    Description: epitope description:QGVQQKWDATATELNNALQNLART antigen name:6 kDa early secretory antigenic target host organism:Macaca mulatta antibody name:anti-ESAT ...

    Publication: 14715573;

  9. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6857

    Description: epitope description:QGVQQKWDATATELNNALQNLART antigen name:6 kDa early secretory antigenic target host organism:Macaca fascicularis antibody name:anti-...

    Publication: 14715573;

  10. Recognition of ESAT-6 sequences by antibodies in sera of tuberculous nonhuman primates.

    ID: 6861

    Description: epitope description:LARTISEAGQAMASTEGNVTGMFA antigen name:6 kDa early secretory antigenic target host organism:Macaca fascicularis antibody name:anti-...

    Publication: 14715573;

  11. B-cell responses in patients who have recovered from severe acute respiratory syndrome target a dominant site in the S2 domain of the surface spike gl...

    ID: 6972

    Description: epitope description:QILPDPLKPTKRSFIEDLLFNKVTLA + ACET(Q1) antigen name:Spike glycoprotein host organism:Homo sapiens antibody name:anti-spike S2 Ab (f...

    Publication: 15731234;

  12. Anti-class II monoclonal antibody-targeted Vibrio cholerae TcpA pilin: modulation of serologic response, epitope specificity, and isotype.

    ID: 7145

    Description: epitope description:ADLGDFENSAAAAETGVGVIKSIA antigen name:UniProt:A5F392 host organism:Mus musculus CBA/J

    Publication: 11705948;

  13. Peptide mimotopes of Mycobacterium tuberculosis carbohydrate immunodeterminants.

    ID: 7277

    Description: epitope description:QEPLMGTVPIRA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15560754;

  14. Peptide mimotopes of Mycobacterium tuberculosis carbohydrate immunodeterminants.

    ID: 7281

    Description: epitope description:DPEQPAPLFLVS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15560754;

  15. Characterization of immunodominant linear B-cell epitopes on the carboxy terminus of the rinderpest virus nucleocapsid protein.

    ID: 7412

    Description: epitope description:PEADTDPL antigen name:Nucleoprotein host organism:Cavia porcellus antibody name:anti-N125

    Publication: 15242937;

  16. The C-terminal antibody binding domain of Candida albicans mp58 represents a protective epitope during candidiasis.

    ID: 7425

    Description: epitope description:YYALDVYAYDVT antigen name:pH-regulated antigen PRA1 host organism:Homo sapiens

    Publication: 15033231;

  17. Induction of opsonic antibodies to the gamma-D-glutamic acid capsule of Bacillus anthracis by immunization with a synthetic peptide-carrier protein co...

    ID: 7428

    Description: epitope description:EEEEEEEEE + D-aa(1, 2, 3, 4, 5, 6, 7, 8, 9) antigen name:SpoVR like family protein host organism:Mus musculus BALB/c antibody name...

    Publication: 15039099;

  18. Characterization of HPV16 L1 loop domains in the formation of a type-specific, conformational epitope.

    ID: 7432

    Description: epitope description:Y75, F76, P77, I78, K79, K80, P81, N82, N83, N84, K85, I86, L87, L148, L149, N150, K151, L152, D153, D154, T155, E156, N157, A158,...

    Publication: 15260888;

  19. Disease-specific B Cell epitopes for serum antibodies from patients with severe acute respiratory syndrome (SARS) and serologic detection of SARS anti...

    ID: 7527

    Description: epitope description:VKIDNASPAS host organism:Homo sapiens antibody name:anti-SARS CoV Ab

    Publication: 15272409;

  20. Disease-specific B Cell epitopes for serum antibodies from patients with severe acute respiratory syndrome (SARS) and serologic detection of SARS anti...

    ID: 7529

    Description: epitope description:VKIDNASPAS host organism:Mus musculus BALB/c antibody name:anti-SARS CoV Ab

    Publication: 15272409;

  21. Disease-specific B Cell epitopes for serum antibodies from patients with severe acute respiratory syndrome (SARS) and serologic detection of SARS anti...

    ID: 7532

    Description: epitope description:VKIDNASPAS host organism:Homo sapiens antibody name:anti-SARS CoV Ab

    Publication: 15272409;

  22. Identification of a dengue virus type 2 (DEN-2) serotype-specific B-cell epitope and detection of DEN-2-immunized animal serum samples using an epitop...

    ID: 7612

    Description: epitope description:SHRLHNTMPSES host organism:Oryctolagus cuniculus

    Publication: 13679612;

  23. Antigenic analysis of nonstructural protein (NSP) 4 of group A avian rotavirus strain PO-13.

    ID: 7633

    Description: epitope description:FKKDEIDMSFETNKK antigen name:Non-structural glycoprotein 4 host organism:Mus musculus BALB/c antibody name:P4 2-2

    Publication: 14584613;

  24. Antigenic analysis of nonstructural protein (NSP) 4 of group A avian rotavirus strain PO-13.

    ID: 7637

    Description: epitope description:MENATTINETLVEEVYNMTMSYFE antigen name:Non-structural glycoprotein 4 host organism:Mus musculus BALB/c antibody name:P4 3-5

    Publication: 14584613;

  25. Antigenic organization of the N-terminal part of the polymorphic outer membrane proteins 90, 91A, and 91B of Chlamydophila abortus.

    ID: 7848

    Description: epitope description:SLVFHKNCSTAE antigen name:Polymorphic outer membrane protein (UniProt:H2VFH0) host organism:Mus musculus BALB/c antibody name:G11

    Publication: 12761105;

  26. Antigenic organization of the N-terminal part of the polymorphic outer membrane proteins 90, 91A, and 91B of Chlamydophila abortus.

    ID: 7852

    Description: epitope description:SPKGGAISIKDS antigen name:Polymorphic outer membrane protein (UniProt:H2VFH0) host organism:Mus musculus antibody name:191

    Publication: 12761105;

  27. Antigenic organization of the N-terminal part of the polymorphic outer membrane proteins 90, 91A, and 91B of Chlamydophila abortus.

    ID: 7856

    Description: epitope description:LRAKDGFGIFFY antigen name:Polymorphic outer membrane protein (UniProt:H2VFH0) host organism:Mus musculus antibody name:FC1A2 & DA4...

    Publication: 12761105;

  28. Characterization of monoclonal antibodies to Marburg virus nucleoprotein (NP) that can be used for NP-capture enzyme-linked immunosorbent assay.

    ID: 7867

    Description: epitope description:WPQRVVTKKGRTFL antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:MAb 2A7

    Publication: 15778962;

  29. Antigenic organization of the N-terminal part of the polymorphic outer membrane proteins 90, 91A, and 91B of Chlamydophila abortus.

    ID: 7871

    Description: epitope description:SGAIYTCEGNVCISYAGKDSPL antigen name:Polymorphic outer membrane protein (UniProt:H2VFH2) host organism:Mus musculus antibody name:J...

    Publication: 12761105;

  30. Antigenic properties of peptidic mimics for epitopes of the lipopolysaccharide from Brucella.

    ID: 8043

    Description: epitope description:GPGQCNTRNPCPRPM host organism:Mus musculus antibody name:A15-6B3

    Publication: 10556037;

  31. Antigenic properties of peptidic mimics for epitopes of the lipopolysaccharide from Brucella.

    ID: 8054

    Description: epitope description:CSIYGSTIAGS host organism:Mus musculus antibody name:B66-2C8

    Publication: 10556037;

  32. Antigenic properties of peptidic mimics for epitopes of the lipopolysaccharide from Brucella.

    ID: 8058

    Description: epitope description:WPPPNMLTS host organism:Mus musculus antibody name:B66-2C8

    Publication: 10556037;

  33. Antigenic properties of peptidic mimics for epitopes of the lipopolysaccharide from Brucella.

    ID: 8062

    Description: epitope description:PWLDISDFQ host organism:Mus musculus antibody name:B66-2C8

    Publication: 10556037;

  34. Monoclonal antibody raised against envelope glycoprotein peptide neutralizes Japanese encephalitis virus.

    ID: 8131

    Description: epitope description:SENHGNYSAQVGASQ antigen name:Genome polyprotein host organism:Mus musculus antibody name:IC10F6

    Publication: 11556718;

  35. N-terminus of M2 protein could induce antibodies with inhibitory activity against influenza virus replication.

    ID: 8133

    Description: epitope description:SLLTEVETPIR antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus

    Publication: 12628550;

  36. Antigenic variants with amino acid deletions clarify a neutralizing epitope specific for influenza B virus Victoria group strains.

    ID: 8380

    Description: epitope description:D164, N165, T170, K203 antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 11514726;

  37. Characterization of BoHV-1 gE envelope glycoprotein mimotopes obtained by phage display.

    ID: 8388

    Description: epitope description:SPSYDIRVPRGW host organism:Mus musculus antibody name:14B11

    Publication: 15530735;

  38. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8429

    Description: epitope description:DVNLHSSR antigen name:Replicase polyprotein 1ab host organism:Homo sapiens

    Publication: 15207612;

  39. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8433

    Description: epitope description:SQASSRSS antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15207612;

  40. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8438

    Description: epitope description:VSDFTDSV antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  41. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8440

    Description: epitope description:GAGICASY antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  42. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8447

    Description: epitope description:AMQMAYRF antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  43. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 8454

    Description: epitope description:LEDPCKV antigen name:Protein non-structural 8a host organism:Homo sapiens

    Publication: 15207612;

  44. Structural basis for helper T-cell and antibody epitope immunodominance in bacteriophage T4 Hsp10. Role of disordered loops.

    ID: 8488

    Description: epitope description:HPFVALGLKQPKEIK antigen name:Capsid assembly protein Gp31 host organism:Mus musculus

    Publication: 11602571;

  45. Conformational epitope mapping of OmpC, a major cell surface antigen from Salmonella typhi.

    ID: 8561

    Description: epitope description:D46, Y231, K173 antigen name:Outer membrane protein C host organism:Mus musculus BALB/c antibody name:P7D8

    Publication: 15363785;

  46. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8686

    Description: epitope description:FTTKVIGKDSRDFDISPKV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  47. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8687

    Description: epitope description:FFVRSIGSKGGKLAAGKYTDAVTV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  48. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8689

    Description: epitope description:FFVRSIGSKGGKLAAGKYTDAVTV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  49. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8691

    Description: epitope description:TSQDGNNHQFT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  50. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8692

    Description: epitope description:TSQDGNNHQFT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  51. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8695

    Description: epitope description:VNGENLVGDDVVLAT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  52. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1575

    Description: epitope description:EVAKNLNESLIDLQELG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  53. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1584

    Description: epitope description:PWYVWLGFIAGLIAIVM antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  54. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1590

    Description: epitope description:MVTILLCCMTSCCSCLK antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  55. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1594

    Description: epitope description:CMTSCCSCLKGACSCGS antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  56. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1595

    Description: epitope description:LKGACSCGSCCKFDEDD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  57. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1600

    Description: epitope description:DDSEPVLKGVKLHYT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  58. Generation and characterization of anti-leptin antisera against synthetic peptides and recombinant protein.

    ID: 1602

    Description: epitope description:AASKSCPLPQVRALESLESL antigen name:Leptin host organism:Oryctolagus cuniculus Japanese white antibody name:anti-peptide 91-110

    Publication: 15647625;

  59. Computational peptide dissection of Melan-a/MART-1 oncoprotein antigenicity.

    ID: 1625

    Description: epitope description:PAYEKL antigen name:Melanoma antigen recognized by T-cells 1 host organism:Mus musculus antibody name:mAb-1

    Publication: 15501517;

  60. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1660

    Description: epitope description:EEEKKEEKKEEKKPDNEITNEVKEEQKYSSPSDINAQNLISN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  61. The primary GP5 neutralization epitope of North American isolates of porcine reproductive and respiratory syndrome virus.

    ID: 1735

    Description: epitope description:SSHLQLIYNLTLTLCELNGTDWLAN antigen name:Other Porcine reproductive and respiratory syndrome virus protein host organism:Mus musculu...

    Publication: 15507310;

  62. Integrin beta3 regions controlling binding of murine mAb 7E3: implications for the mechanism of integrin alphaIIbbeta3 activation.

    ID: 1994

    Description: epitope description:W155, S156, I157, Q158, N159, C203, Y204, D205, M206, K207, T208, T209, C210 antigen name:Integrin beta-3 host organism:Mus muscul...

    Publication: 15277669;

  63. Crystal structure of a Fab complex formed with PfMSP1-19, the C-terminal fragment of merozoite surface protein 1 from Plasmodium falciparum: a malaria...

    ID: 2054

    Description: epitope description:V1533, K1534, K1535, Q1536, P1538, Q1539, D1548, E1549, R1550, E1551, C1553, G1563, D1564 antigen name:Merozoite surface protein 1...

    Publication: 12729744;

  64. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2065

    Description: epitope description:MTEQQWNFAGIEAAAS antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens antibody name:Human sera

    Publication: 15325505;

  65. High epitope density in a single protein molecule significantly enhances antigenicity as well as immunogenicity: a novel strategy for modern vaccine d...

    ID: 2125

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15627976;

  66. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2143

    Description: epitope description:AAASAIQGNVTSIHSL antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  67. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2152

    Description: epitope description:NVTSIHSLLDEGKQSL antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  68. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2157

    Description: epitope description:LDEGKQSLTKLAAAWG antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  69. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2955

    Description: epitope description:VELLSFLPSDFF antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  70. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2967

    Description: epitope description:PSVRDLLDTASA antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  71. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2974

    Description: epitope description:LDTASALYREAL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  72. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3016

    Description: epitope description:CWGELMTLATWV antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  73. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3064

    Description: epitope description:TFGRETVLEYLV antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  74. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3069

    Description: epitope description:VLEYLVSFGVWI antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  75. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3088

    Description: epitope description:RPPNAPILSTLP antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  76. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3107

    Description: epitope description:RRGRSPRRRTPS antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  77. Structural investigation of Borrelia burgdorferi OspB, a bactericidal Fab target.

    ID: 3294

    Description: epitope description:G231, S232, N233, A250, D251, S252, K253, K254, N272, T273, A274, G275, T276 antigen name:Outer surface protein B host organism:Mu...

    Publication: 15713683;

  78. The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 an...

    ID: 3298

    Description: epitope description:P330, N331, D332, P333, T334, Y342, G344, N345, I367, I369, A370, S371, S373, N400, T401, W403 antigen name:Neuraminidase host org...

    Publication: 7994573;

  79. Epitope specificity of monoclonal antibodies to the N-protein of porcine reproductive and respiratory syndrome virus determined by ELISA with syntheti...

    ID: 3544

    Description: epitope description:VNQLCQLLGAMIKSQRQQPRGGQAKKKK antigen name:Nucleoprotein host organism:Sus scrofa

    Publication: 15661331;

  80. A novel site contributing to growth-arrest-specific gene 6 binding to its receptors as revealed by a human monoclonal antibody.

    ID: 3576

    Description: epitope description:IAVAGDLFQPER antigen name:Growth arrest-specific protein 6 host organism:Mus musculus (CBA/J X C57BL/6J) human IgH Tg human IgL Tg...

    Publication: 15579134;

  81. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 3577

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  82. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 3578

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  83. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4128

    Description: epitope description:STQSNPKPRI antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  84. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4129

    Description: epitope description:VAIGDQILDL antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  85. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4133

    Description: epitope description:FDETTLNNFM antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  86. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4134

    Description: epitope description:FDETTLNNFM antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  87. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4135

    Description: epitope description:GQAAWKEARA antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  88. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4140

    Description: epitope description:EHIFGMVLMN antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  89. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4141

    Description: epitope description:MSFIPVAEDS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  90. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4143

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  91. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4144

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  92. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4150

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  93. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4154

    Description: epitope description:LPVGYHGRAS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  94. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4156

    Description: epitope description:YHGRASSIVV antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  95. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4164

    Description: epitope description:KELRQRAFTS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  96. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8699

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  97. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8701

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  98. Human recombinant neutralizing antibodies against hantaan virus G2 protein.

    ID: 8862

    Description: epitope description:KVMATIDSF antigen name:Hantaan orthohantavirus protein host organism:Homo sapiens antibody name:multiple

    Publication: 12706090;

  99. Role of S-layer protein antigenic diversity in the immune responses of sheep experimentally challenged with Campylobacter fetus subsp. fetus.

    ID: 8940

    Description: epitope description:MLNKTDVSMLYITIMGMASE antigen name:UniProt:A0A089VTC6 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12496160;

  100. N-terminus of M2 protein could induce antibodies with inhibitory activity against influenza virus replication.

    ID: 8945

    Description: epitope description:ETPIRNEWGCR antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus

    Publication: 12628550;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston