Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475135

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  2. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475140

    Description: epitope description:AAINSVKDTTGVEASIDANGQLLLTSREGR antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  3. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475157

    Description: epitope description:NYGRLSLVKNDGKDILISGSNLSSAGFGAT antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  4. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475162

    Description: epitope description:NYGRLSLVKNDGKDILISGSNLSSAGFGAT antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  5. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475170

    Description: epitope description:GFGATQFISQASVSLRESKGQIDANIADAM antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  6. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475175

    Description: epitope description:GFGATQFISQASVSLRESKGQIDANIADAM antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  7. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475177

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  8. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475181

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  9. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475183

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  10. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475185

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  11. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475193

    Description: epitope description:MSSAGSGFSSGSGYSVGSGKNYSTGFANAI antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  12. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475199

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  13. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475203

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  14. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475204

    Description: epitope description:FANAIAISAASQLSTVYNVSAGSGFSSGST antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  15. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475208

    Description: epitope description:SSGSTLSQFATMKTTAFGVKDETAGVTTLK antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  16. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475211

    Description: epitope description:SSGSTLSQFATMKTTAFGVKDETAGVTTLK antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  17. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475217

    Description: epitope description:VTTLKGAMAVMDIAETAITNLDQIRADIGS antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  18. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475218

    Description: epitope description:VTTLKGAMAVMDIAETAITNLDQIRADIGS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  19. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475228

    Description: epitope description:ADIGSVQNQVTSTINNITVTQVNVKAAESQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  20. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475233

    Description: epitope description:ADIGSVQNQVTSTINNITVTQVNVKAAESQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  21. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475236

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  22. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475238

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  23. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475240

    Description: epitope description:AAESQIRDVDFAAESANYSKANILAQSGSY antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  24. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475251

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  25. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475254

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  26. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475255

    Description: epitope description:YSKANILAQSGSYAMAQANSVQQNVLRLLQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  27. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475276

    Description: epitope description:SQQIKMANKKMKKEQ antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  28. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475281

    Description: epitope description:GVITQVKYQGGCGRG antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  29. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475285

    Description: epitope description:EPAHAIATGDLVSLS antigen name:Other Glycine max (soybeans) protein host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  30. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475297

    Description: epitope description:IDGYETVIMSDESTE antigen name:Other Glycine max (soybeans) protein host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  31. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475298

    Description: epitope description:VIMSDESTESETEQA antigen name:Other Glycine max (soybeans) protein host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  32. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475299

    Description: epitope description:STESETEQAFLSAIL antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  33. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475305

    Description: epitope description:DGENCTSPYGINHFV antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  34. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475315

    Description: epitope description:NYFASYPTKEESETL antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 9751845;

  35. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475318

    Description: epitope description:AYSNCYPYDVPDYASLR antigen name:Hemagglutinin host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  36. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475320

    Description: epitope description:LNWLHQLK antigen name:Hemagglutinin host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  37. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475326

    Description: epitope description:ITYGACPRYVK antigen name:Hemagglutinin host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  38. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475327

    Description: epitope description:ITYGACPRYVK antigen name:Hemagglutinin host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  39. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475334

    Description: epitope description:LTILVALALFLLAAH antigen name:Ara h 2 host organism:Homo sapiens antibody name:serum pool

    Publication: 9186485;

  40. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475342

    Description: epitope description:SARQQWELQGDRRCQ antigen name:Ara h 2 host organism:Homo sapiens antibody name:serum pool

    Publication: 9186485;

  41. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475344

    Description: epitope description:QLERANLRPCEQHLM antigen name:Ara h 2 host organism:Homo sapiens antibody name:serum pool

    Publication: 9186485;

  42. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475349

    Description: epitope description:PYDRRGAGSSQHQER antigen name:Ara h 2 host organism:Homo sapiens antibody name:serum pool

    Publication: 9186485;

  43. Identification and mutational analysis of the immunodominant IgE binding epitopes of the major peanut allergen Ara h 2.

    ID: 1475353

    Description: epitope description:ALQQIMENQSDRLQG antigen name:Ara h 2 host organism:Homo sapiens antibody name:serum pool

    Publication: 9186485;

  44. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475372

    Description: epitope description:GSVNSFFSRLNWL antigen name:Hemagglutinin host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  45. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475378

    Description: epitope description:FQTAAQR antigen name:Nucleoprotein host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  46. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475382

    Description: epitope description:RCKANKIQDK antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:patient sera

    Publication: 9751845;

  47. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475387

    Description: epitope description:FQTAAQR antigen name:Nucleoprotein host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  48. Antigenic characterisation of H3N2 subtypes of the influenza virus by mass spectrometry.

    ID: 1475388

    Description: epitope description:GVQIASNENMDSIVSSTLELR antigen name:Nucleoprotein host organism:Mus musculus antibody name:Clone 12/5 (mAb)

    Publication: 17588679;

  49. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475395

    Description: epitope description:EAKRLEIFKN antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:patient sera

    Publication: 9751845;

  50. Cellular and molecular characterization of a major soybean allergen.

    ID: 1475396

    Description: epitope description:IFKNNSNYIR antigen name:P34 probable thiol protease host organism:Homo sapiens antibody name:patient sera

    Publication: 9751845;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston