Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Viral infection modulation and neutralization by camelid nanobodies.

    ID: 1989956

    Description: epitope description:A2, S3, I4, K5, D20, D21, E23, A24, S27, E28, G32, G33, N34, D41, E42, T43 antigen name:BPP host organism:Lama glama antibody name...

    Publication: 23530214;

  2. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989975

    Description: epitope description:Y364, K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM5-1

    Publication: 23740990;

  3. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989977

    Description: epitope description:K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM1-6, SM3-1, SM6-5

    Publication: 23740990;

  4. Characterization of a discontinuous neutralizing epitope on glycoprotein B of human cytomegalovirus.

    ID: 1989983

    Description: epitope description:K379 antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:SM6-5

    Publication: 23740990;

  5. A strain-specific epitope of enterovirus 71 identified by cryo-electron microscopy of the complex with fab from neutralizing antibody.

    ID: 1989989

    Description: epitope description:E663, G710, K807 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:MA28-7

    Publication: 23946455;

  6. New ELISAs with high specificity for soluble oligomers of amyloid beta-protein detect natural Abeta oligomers in human brain but not CSF.

    ID: 1990005

    Description: epitope description:GLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:2G3

    Publication: 23375565;

  7. New ELISAs with high specificity for soluble oligomers of amyloid beta-protein detect natural Abeta oligomers in human brain but not CSF.

    ID: 1990015

    Description: epitope description:EFRHDS antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6E10

    Publication: 23375565;

  8. Comprehensive mapping of common immunodominant epitopes in the eastern equine encephalitis virus E2 protein recognized by avian antibody responses.

    ID: 1990286

    Description: epitope description:PYLGFCPYCRHST antigen name:Structural polyprotein host organism:Anas

    Publication: 23922704;

  9. The toxicity of antiprion antibodies is mediated by the flexible tail of the prion protein.

    ID: 1990297

    Description: epitope description:I138, H139, F140, G141, N142, D143, W144, E145, D146, R147, M204, V208, M212 antigen name:Major prion protein host organism:Mus mu...

    Publication: 23903654;

  10. The toxicity of antiprion antibodies is mediated by the flexible tail of the prion protein.

    ID: 1990300

    Description: epitope description:GQPHGGGW antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:POM2

    Publication: 23903654;

  11. The toxicity of antiprion antibodies is mediated by the flexible tail of the prion protein.

    ID: 1990302

    Description: epitope description:YSNQNNF antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:POM5

    Publication: 23903654;

  12. The toxicity of antiprion antibodies is mediated by the flexible tail of the prion protein.

    ID: 1990304

    Description: epitope description:F140, E145, N170, F174 antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:POM8, POM9

    Publication: 23903654;

  13. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 1990719

    Description: epitope description:N248, K249, A250 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:3A2

    Publication: 23785204;

  14. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 1990720

    Description: epitope description:N248, K249, A250 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:3A2

    Publication: 23785204;

  15. Co-expression of the Bcl-xL antiapoptotic protein enhances the induction of Th1-like immune responses in mice immunized with DNA vaccines encoding FMD...

    ID: 1996993

    Description: epitope description:TTTYTASARGDLAHLTTTHARHL antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 23483312;

  16. Co-expression of the Bcl-xL antiapoptotic protein enhances the induction of Th1-like immune responses in mice immunized with DNA vaccines encoding FMD...

    ID: 1996994

    Description: epitope description:YFLIEKGQHEAAIEFFEGMVHDSIKEELRP antigen name:Polyprotein host organism:Mus musculus antibody name:2C2

    Publication: 23483312;

  17. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 1996997

    Description: epitope description:N248, K249, A250 antigen name:Neuraminidase host organism:Mus musculus BALB/c

    Publication: 23785204;

  18. Heavy chain-only IgG2b llama antibody effects near-pan HIV-1 neutralization by recognizing a CD4-induced epitope that includes elements of coreceptor-...

    ID: 1997000

    Description: epitope description:C118, V119, L121, V196, G319, D320, I321, R322, Q323, D363, P364, V367, T368, Y379, N381, P404, C405, R406, I407, K408, Q409, I410...

    Publication: 23843638;

  19. Heavy chain-only IgG2b llama antibody effects near-pan HIV-1 neutralization by recognizing a CD4-induced epitope that includes elements of coreceptor-...

    ID: 1997011

    Description: epitope description:C118, V119, L121, V196, G319, D320, I321, R322, Q323, D363, P364, V367, T368, Y379, N381, P404, C405, R406, I407, K408, Q409, I410...

    Publication: 23843638;

  20. Heavy chain-only IgG2b llama antibody effects near-pan HIV-1 neutralization by recognizing a CD4-induced epitope that includes elements of coreceptor-...

    ID: 1997014

    Description: epitope description:C118, V119, L121, V196, G319, D320, I321, R322, Q323, D363, P364, V367, T368, Y379, N381, P404, C405, R406, I407, K408, Q409, I410...

    Publication: 23843638;

  21. Fine specificity of anti-citrullinated peptide antibodies discloses a heterogeneous antibody population in rheumatoid arthritis.

    ID: 1997027

    Description: epitope description:GARGLTGRPGDAGPPGPP + CITR(R3, R8) antigen name:Collagen alpha-1(VIII) chain host organism:Homo sapiens

    Publication: 23711220;

  22. Fine specificity of anti-citrullinated peptide antibodies discloses a heterogeneous antibody population in rheumatoid arthritis.

    ID: 1997030

    Description: epitope description:SHQESTRGRSRGRSGRSG + CITR(R6, R8) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 23711220;

  23. Fine specificity of anti-citrullinated peptide antibodies discloses a heterogeneous antibody population in rheumatoid arthritis.

    ID: 1997032

    Description: epitope description:EPLGLQFINDFFTYHIRH antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 23711220;

  24. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 1997045

    Description: epitope description:T339 antigen name:Neuraminidase host organism:Mus musculus BALB/c

    Publication: 23785204;

  25. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 1997050

    Description: epitope description:T339 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:1H5

    Publication: 23785204;

  26. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000394

    Description: epitope description:T397 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:3H4, 1H8

    Publication: 23785204;

  27. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000405

    Description: epitope description:T339 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:1H5, 2D9, 2G6

    Publication: 23785204;

  28. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000418

    Description: epitope description:YLIPPGL host organism:Sus scrofa

    Publication: 23845304;

  29. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000419

    Description: epitope description:FTPPVTL host organism:Sus scrofa

    Publication: 23845304;

  30. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000420

    Description: epitope description:TYLPGPL host organism:Sus scrofa

    Publication: 23845304;

  31. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000422

    Description: epitope description:DPPREIS host organism:Sus scrofa

    Publication: 23845304;

  32. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000425

    Description: epitope description:IAKPGFW host organism:Sus scrofa

    Publication: 23845304;

  33. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000440

    Description: epitope description:I396, W456 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:2D4

    Publication: 23785204;

  34. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000442

    Description: epitope description:I396, W456 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:2D4

    Publication: 23785204;

  35. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000443

    Description: epitope description:I396, W456 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:2D4

    Publication: 23785204;

  36. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000444

    Description: epitope description:GNLFGRD host organism:Mus musculus Kunming

    Publication: 23845304;

  37. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000446

    Description: epitope description:N309 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:4C4

    Publication: 23785204;

  38. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000453

    Description: epitope description:V338 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:4E9

    Publication: 23785204;

  39. Epitope screening of the PCV2 Cap protein by use of a random peptide-displayed library and polyclonal antibody.

    ID: 2000462

    Description: epitope description:SISFWTL host organism:Mus musculus Kunming

    Publication: 23845304;

  40. Molecular basis for broad neuraminidase immunity: conserved epitopes in seasonal and pandemic H1N1 as well as H5N1 influenza viruses.

    ID: 2000470

    Description: epitope description:T339 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:1H5

    Publication: 23785204;

  41. Development and preclinical characterization of a humanized antibody targeting CXCL12.

    ID: 2000485

    Description: epitope description:E36, S37, H38, V39, A40, R41, A42, N43, L63, K64, N65, N66, N67, R68, V70, W78 antigen name:Stromal cell-derived factor 1 host org...

    Publication: 23812669;

  42. Development and preclinical characterization of a humanized antibody targeting CXCL12.

    ID: 2000486

    Description: epitope description:E36, S37, H38, V39, A40, R41, A42, N43, L63, K64, N65, N66, N67, R68, V70, W78 antigen name:Stromal cell-derived factor 1 host org...

    Publication: 23812669;

  43. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000496

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:5p1:3

    Publication: 23761636;

  44. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000497

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:1p1:8

    Publication: 23761636;

  45. Carrier protein influences immunodominance of a known epitope: implication in peptide vaccine design.

    ID: 2000519

    Description: epitope description:LEDARRLKAIYEKKK antigen name:Other Escherichia coli protein host organism:Mus musculus BALB/c

    Publication: 23928464;

  46. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000524

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:p1-20

    Publication: 23761636;

  47. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000525

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:Clone 10

    Publication: 23761636;

  48. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000527

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:p1-20

    Publication: 23761636;

  49. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000532

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:p1-15

    Publication: 23761636;

  50. Phl p 1-specific human monoclonal IgE and design of a hypoallergenic group 1 grass pollen allergen fragment.

    ID: 2000538

    Description: epitope description:K176, N179, D223 antigen name:Phl p 1 host organism:Homo sapiens antibody name:Clone 10

    Publication: 23761636;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston