Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Structure of active beta-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.

    ID: 2009286

    Description: epitope description:R7, H210, G211, P213, T275, P276, F277, L278, A279, R282, D297, T298, N299, L300, H353, P354, E358, P361 antigen name:Beta-arresti...

    Publication: 23604254;

  2. Murine lupus anti-DNA antibodies cross-react with the hapten (4-hydroxy-5-iodo-3-nitrophenyl)acetyl, but immunization-induced anti-DNA antibodies do n...

    ID: 2009288

    Description: epitope description:(4-hydroxy-3-nitrophenyl)acetyl group host organism:Mus musculus SJL antibody name:S1-26.1

    Publication: 3569407;

  3. Murine lupus anti-DNA antibodies cross-react with the hapten (4-hydroxy-5-iodo-3-nitrophenyl)acetyl, but immunization-induced anti-DNA antibodies do n...

    ID: 2009289

    Description: epitope description:(4-hydroxy-3-nitrophenyl)acetyl group host organism:Mus musculus C57BL/6 antibody name:P9.10.4

    Publication: 3569407;

  4. Murine lupus anti-DNA antibodies cross-react with the hapten (4-hydroxy-5-iodo-3-nitrophenyl)acetyl, but immunization-induced anti-DNA antibodies do n...

    ID: 2009290

    Description: epitope description:(4-hydroxy-3-nitrophenyl)acetyl group host organism:Mus musculus C57BL/6 antibody name:P9.10.4

    Publication: 3569407;

  5. Epitope mapping and characterization of a neutralizing monoclonal antibody against human adenovirus type 3.

    ID: 2009292

    Description: epitope description:GPGHRYQGIKVKTDDANGWEKDANVDTANE antigen name:hexon (GenPept:197944742) host organism:Mus musculus BALB/c antibody name:1B6

    Publication: 24018287;

  6. A human monoclonal antibody with neutralizing activity against highly divergent influenza subtypes.

    ID: 2009332

    Description: epitope description:H25, H45, I361, D362 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:PN-SIA28

    Publication: 22162996;

  7. A human monoclonal antibody with neutralizing activity against highly divergent influenza subtypes.

    ID: 2009339

    Description: epitope description:H25, H45, I361, D362 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:PN-SIA28

    Publication: 22162996;

  8. Immunochemical detection of sequence-specific modifications to DNA induced by UV light.

    ID: 2009471

    Description: epitope description:dT8 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7525097;

  9. Immunochemical detection of sequence-specific modifications to DNA induced by UV light.

    ID: 2009472

    Description: epitope description:dT10 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7525097;

  10. Monoclonal antibodies to 5'-triphospho-(2'-5')adenyladenosine oligonucleotides.

    ID: 2009569

    Description: epitope description:A2'p5'A host organism:Rattus norvegicus LOU

    Publication: 6181514;

  11. Identification of novel B cell epitopes within Toxoplasma gondii GRA1.

    ID: 2011644

    Description: epitope description:QGLGIGESVELEMMGNTYRV antigen name:Dense granule protein GRA1 host organism:Sus scrofa

    Publication: 24090568;

  12. Identification of novel B cell epitopes within Toxoplasma gondii GRA1.

    ID: 2011655

    Description: epitope description:VSAVASVVQDEMNVIDDVQQ antigen name:Dense granule protein GRA1 host organism:Sus scrofa

    Publication: 24090568;

  13. Identification of novel B cell epitopes within Toxoplasma gondii GRA1.

    ID: 2011657

    Description: epitope description:LEKDKQQLKDDIGFLTGERE antigen name:Dense granule protein GRA1 host organism:Sus scrofa

    Publication: 24090568;

  14. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011659

    Description: epitope description:IKHQGLPQEVLNENL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  15. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011662

    Description: epitope description:LNENLLRFFVAPFPE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  16. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011686

    Description: epitope description:VEQKHIQKEDVPSER antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  17. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011689

    Description: epitope description:IQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  18. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011692

    Description: epitope description:YLGYLEQLLRLKKYK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  19. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011693

    Description: epitope description:YLGYLEQLLRLKKYK antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  20. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011697

    Description: epitope description:LKKYKVPQLEIVPNS antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  21. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011699

    Description: epitope description:VPQLEIVPNSAEERL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  22. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011703

    Description: epitope description:AEERLHSMKEGIHAQ antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  23. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011717

    Description: epitope description:RQFYQLDAYPSGAWY antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  24. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011722

    Description: epitope description:SGAWYYVPLGTQYTD antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  25. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011723

    Description: epitope description:YVPLGTQYTDAPSFS antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  26. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011724

    Description: epitope description:YVPLGTQYTDAPSFS antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  27. Identification of the critical amino acid residues of immunoglobulin E and immunoglobulin G epitopes on alphas1-casein by alanine scanning analysis.

    ID: 2011728

    Description: epitope description:APSFSDIPNPIGSEN antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 24035023;

  28. Chimeric derivatives of hepatitis B virus core particles carrying major epitopes of the rubella virus E1 glycoprotein.

    ID: 2011742

    Description: epitope description:LVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQAR antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 24006140;

  29. Chimeric derivatives of hepatitis B virus core particles carrying major epitopes of the rubella virus E1 glycoprotein.

    ID: 2011749

    Description: epitope description:QQSRWGLGSPNCHGPDWASPVCQRHSP antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 24006140;

  30. Chimeric derivatives of hepatitis B virus core particles carrying major epitopes of the rubella virus E1 glycoprotein.

    ID: 2011751

    Description: epitope description:LVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQAR antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 24006140;

  31. Mimotopic peptide immunotherapy for the treatment of multiple sclerosis, an inflammatory autoimmune disease.

    ID: 2012297

    Description: epitope description:ADARM antigen name:Myelin proteolipid protein host organism:Homo sapiens Caucasian

    Publication: 24179729;

  32. Mimotopic peptide immunotherapy for the treatment of multiple sclerosis, an inflammatory autoimmune disease.

    ID: 2012299

    Description: epitope description:ADARM antigen name:Myelin proteolipid protein host organism:Homo sapiens Caucasian

    Publication: 24179729;

  33. Mimotopic peptide immunotherapy for the treatment of multiple sclerosis, an inflammatory autoimmune disease.

    ID: 2012311

    Description: epitope description:IENLH antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Homo sapiens Caucasian

    Publication: 24179729;

  34. In type 1 diabetes a subset of anti-coxsackievirus B4 antibodies recognize autoantigens and induce apoptosis of pancreatic beta cells.

    ID: 2012321

    Description: epitope description:SNLQHIRRDVRP host organism:Homo sapiens

    Publication: 23469060;

  35. In type 1 diabetes a subset of anti-coxsackievirus B4 antibodies recognize autoantigens and induce apoptosis of pancreatic beta cells.

    ID: 2012324

    Description: epitope description:SNLQHIRRDVRP host organism:Homo sapiens

    Publication: 23469060;

  36. Facile fabrication and instant application of miniaturized antibody-decorated affinity columns for higher-order structure and functional characterizat...

    ID: 2012336

    Description: epitope description:NFLVEEEQRQLQELEKDEREQLRILGEK antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Oryctolagus cuniculus

    Publication: 24094071;

  37. An inhibitory antibody blocks the first step in the dithiol/disulfide relay mechanism of the enzyme QSOX1.

    ID: 2012337

    Description: epitope description:W69, G71, H72, F76, R111, N114, P116, F118, P119, T120, R122, S132, G133, V135, P137, V138, A139, R149 antigen name:Sulfhydryl oxi...

    Publication: 23867277;

  38. Adrenaline-activated structure of beta2-adrenoceptor stabilized by an engineered nanobody.

    ID: 2012364

    Description: epitope description:T68, R131, A134, I135, T136, P138, F139, A226, Q229, L230, K267, E268, A271, T274, L275, I278, Y326, R328, S329, P330 antigen name...

    Publication: 24056936;

  39. Adrenaline-activated structure of beta2-adrenoceptor stabilized by an engineered nanobody.

    ID: 2012367

    Description: epitope description:T68, R131, A134, I135, T136, P138, F139, A226, Q229, L230, K267, E268, A271, T274, L275, I278, Y326, R328, S329, P330 antigen name...

    Publication: 24056936;

  40. Isolation, kinetic analysis, and structural characterization of an antibody targeting the Bacillus anthracis major spore surface protein BclA.

    ID: 2012373

    Description: epitope description:I332, N333, D334, S350, Q351, L352, D353, Q385, N387, G388, E421 antigen name:Collagen triple helix repeat domain protein host org...

    Publication: 21322055;

  41. Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1.

    ID: 2012452

    Description: epitope description:VFAAPTLMSFLRCGAMASDPPLVANQVVTC antigen name:Major surface antigen host organism:Sus scrofa

    Publication: 23631709;

  42. Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1.

    ID: 2012455

    Description: epitope description:IPEAEDSWWTGDSASLDTAGIKLTVPIEKF antigen name:Major surface antigen host organism:Sus scrofa

    Publication: 23631709;

  43. Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1.

    ID: 2012457

    Description: epitope description:SSVVNNVARCSYGANSTLGPVKLSAEGPTT antigen name:Major surface antigen host organism:Sus scrofa

    Publication: 23631709;

  44. Universal anti-neuraminidase antibody inhibiting all influenza A subtypes.

    ID: 2012524

    Description: epitope description:I222, E227 antigen name:Neuraminidase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 24091204;

  45. High-avidity and potently neutralizing cross-reactive human monoclonal antibodies derived from secondary dengue virus infection.

    ID: 2012617

    Description: epitope description:T76, W101, G106, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:753C6, 753C8

    Publication: 24027331;

  46. High-avidity and potently neutralizing cross-reactive human monoclonal antibodies derived from secondary dengue virus infection.

    ID: 2012624

    Description: epitope description:T76, W101, G106, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:753C6, 753C8

    Publication: 24027331;

  47. High-avidity and potently neutralizing cross-reactive human monoclonal antibodies derived from secondary dengue virus infection.

    ID: 2012625

    Description: epitope description:T76, W101, G106, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:753C6, 753C8

    Publication: 24027331;

  48. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2012783

    Description: epitope description:SNNNCTNQVAWCQMQV host organism:Mus musculus NZB X NZW antibody name:F14.6

    Publication: 9174614;

  49. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2012788

    Description: epitope description:AKYSCQKTMCYGLV host organism:Mus musculus NZB X NZW antibody name:J20.8

    Publication: 9174614;

  50. Mimotopes of polyreactive anti-DNA antibodies identified using phage-display peptide libraries.

    ID: 2012800

    Description: epitope description:GSRNCPTTKTHCRDTT host organism:Mus musculus NZB X NZW antibody name:J20.8

    Publication: 9174614;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston