Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483083

    Description: epitope description:HWYISKPQ host organism:Mus musculus BALB/c antibody name:MAb 19

    Publication: 9499058;

  2. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483096

    Description: epitope description:HPYISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  3. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483097

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  4. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483098

    Description: epitope description:CDNPASTTNKDKDNPASTTNKDKDNPASTTNKDK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;

  5. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483107

    Description: epitope description:ARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston