Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A novel peptide isolated from a phage display peptide library with trastuzumab can mimic antigen epitope of HER-2.

    ID: 5600

    Description: epitope description:LLGPYELWELSH host organism:Mus musculus BALB/c

    Publication: 15536075;

  2. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5635

    Description: epitope description:GTTLPK antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15207612;

  3. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5638

    Description: epitope description:LPQRQKKQ antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15207612;

  4. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5646

    Description: epitope description:QGTDYKHW antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15207612;

  5. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5647

    Description: epitope description:YLTQDL antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  6. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5654

    Description: epitope description:ALNCYW antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  7. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5658

    Description: epitope description:VSDFTDSV antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  8. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5669

    Description: epitope description:GSFCTQLN antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15207612;

  9. SARS corona virus peptides recognized by antibodies in the sera of convalescent cases.

    ID: 5676

    Description: epitope description:ITVEELKQ antigen name:Membrane protein host organism:Homo sapiens

    Publication: 15207612;

  10. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 807

    Description: epitope description:QSNQRSAPRITFGGPTDS antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  11. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 809

    Description: epitope description:RITFGGPTDSTDNNQNGGR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  12. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 812

    Description: epitope description:STDNNQNGGRNGARPKQR antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  13. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 815

    Description: epitope description:RPKQRRPQGLPNNTASWF antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  14. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 819

    Description: epitope description:WFTALTQHGKEELRFPR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  15. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 820

    Description: epitope description:WFTALTQHGKEELRFPR antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  16. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 838

    Description: epitope description:GKMKELSPRWYFYYL antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  17. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 839

    Description: epitope description:LSPRWYFYYLGTGPEASL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  18. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 841

    Description: epitope description:YLGTGPEASLPYGANK antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  19. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 845

    Description: epitope description:ANKEGIVWVATEGALN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  20. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 851

    Description: epitope description:IGTRNPNNNAATVLQL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  21. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 860

    Description: epitope description:SRGGSQASSRSSSRSR antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  22. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 861

    Description: epitope description:ASSRSSSRSRGNSRNST antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  23. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 863

    Description: epitope description:RSRGNSRNSTPGSSR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  24. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 867

    Description: epitope description:SRGNSPARMASGGGETAL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  25. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 869

    Description: epitope description:MASGGGETALALLLLDRL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  26. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 886

    Description: epitope description:KRTATKQYNVTQAFGRR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  27. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 888

    Description: epitope description:YNVTQAFGRRGPEQTQGNF antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  28. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 889

    Description: epitope description:YNVTQAFGRRGPEQTQGNF antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  29. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 898

    Description: epitope description:QFAPSASAFFGMSRIGM antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  30. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 899

    Description: epitope description:QFAPSASAFFGMSRIGM antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  31. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 900

    Description: epitope description:FFGMSRIGMEVTPSGTW antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  32. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 913

    Description: epitope description:KTFPPTEPKKDKKKK antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  33. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 928

    Description: epitope description:QPLPQRQKKQPTVTLL antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  34. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 933

    Description: epitope description:DFSRQLQNSMSGASA antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 15528730;

  35. Mapping of antigenic sites on the nucleocapsid protein of the severe acute respiratory syndrome coronavirus.

    ID: 934

    Description: epitope description:DFSRQLQNSMSGASA antigen name:Nucleoprotein host organism:Mus musculus BALB/c

    Publication: 15528730;

  36. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 973

    Description: epitope description:MFIFLLFLTLTSGSDLD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  37. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1185

    Description: epitope description:KPTTFMLKYDENGTITD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  38. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1188

    Description: epitope description:MLKYDENGTITDAVDCS antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  39. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1191

    Description: epitope description:TITDAVDCSQNPLAELK antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  40. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1194

    Description: epitope description:CSQNPLAELKCSVKSFE antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  41. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1196

    Description: epitope description:LKCSVKSFEIDKGIYQT antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  42. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1197

    Description: epitope description:LKCSVKSFEIDKGIYQT antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  43. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1205

    Description: epitope description:TSNFRVVPSGDVVRFPN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  44. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1216

    Description: epitope description:FNATKFPSVYAWERKKI antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  45. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1218

    Description: epitope description:FNATKFPSVYAWERKKI antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  46. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1219

    Description: epitope description:PSVYAWERKKISNCVAD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  47. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1220

    Description: epitope description:PSVYAWERKKISNCVAD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  48. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1230

    Description: epitope description:FFSTFKCYGVSATKLND antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  49. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1234

    Description: epitope description:KLNDLCFSNVYADSFVV antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  50. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1242

    Description: epitope description:VKGDDVRQIAPGQTGVI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  51. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1254

    Description: epitope description:IADYNYKLPDDFMGCVL antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  52. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1261

    Description: epitope description:CVLAWNTRNIDATSTGN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  53. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1263

    Description: epitope description:NIDATSTGNYNYKYRYL antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  54. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1269

    Description: epitope description:LRHGKLRPFERDISNVP antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  55. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1278

    Description: epitope description:SPDGKPCTPPALNCYWP antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  56. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1299

    Description: epitope description:CGPKLSTDLIKNQCVNF antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  57. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1312

    Description: epitope description:RFQPFQQFGRDVSDFTD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  58. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4167

    Description: epitope description:NVGIMFRGKE antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  59. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4170

    Description: epitope description:MFRGKENALL antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  60. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4175

    Description: epitope description:TTQTKPKSAF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  61. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4179

    Description: epitope description:GDHCEGLGVL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  62. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4182

    Description: epitope description:ANAEALNNLL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  63. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4187

    Description: epitope description:STETVEVSQG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  64. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4222

    Description: epitope description:MSFVPGQENA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  65. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4226

    Description: epitope description:GQQKQLLPRW antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  66. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4231

    Description: epitope description:VYVRPIIEDY antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  67. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4233

    Description: epitope description:LQFGYTSRSM antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  68. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4238

    Description: epitope description:GNYRLPSNKP antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  69. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4247

    Description: epitope description:RELQKRLYSN antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  70. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 4454

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  71. Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

    ID: 4543

    Description: epitope description:ENLLKEAIRAIFPSR antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15474522;

  72. Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

    ID: 4549

    Description: epitope description:LSSVVVDPSIRHFDV antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15474522;

  73. Novel biomarker of HTLV-1-associated disease: specific appearance of antibody recognizing the receptor-binding site on HTLV-1 envelope protein.

    ID: 4603

    Description: epitope description:DHILEPSIPWKSKLLTLVQL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15504252;

  74. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4708

    Description: epitope description:LNPKTNKWEDK antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  75. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4711

    Description: epitope description:INQQLNPK antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  76. Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

    ID: 4716

    Description: epitope description:LNPKTNKWEDKRY antigen name:Asp f 1 host organism:Homo sapiens

    Publication: 15138181;

  77. Recognition of a cell-surface oligosaccharide of pathogenic Salmonella by an antibody Fab fragment.

    ID: 4737

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody ...

    Publication: 1713710;

  78. Discovery of human antibodies against the C5aR target using phage display technology.

    ID: 1036

    Description: epitope description:MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN antigen name:C5a anaphylatoxin chemotactic receptor 1 host organism:Homo sapiens antibody name:IgG...

    Publication: 15706605;

  79. Identification of a transiently exposed VE-cadherin epitope that allows for specific targeting of an antibody to the tumor neovasculature.

    ID: 1048

    Description: epitope description:DWIWNQMHIDEEKNE antigen name:Cadherin-5 host organism:Rattus norvegicus Lewis antibody name:E4G10

    Publication: 15701713;

  80. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1077

    Description: epitope description:CTDVSTAIHADQLTPAWRIYSTGNNVFQTQAG antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  81. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1097

    Description: epitope description:FRSDTLYLTQDLFLPFY antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  82. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1106

    Description: epitope description:HTINHTFGNPVIPFKDG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  83. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1112

    Description: epitope description:DGIYFAATEKSNVVRGW antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  84. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1124

    Description: epitope description:IINNSTNVVIRACNFEL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  85. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1125

    Description: epitope description:IINNSTNVVIRACNFEL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  86. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1131

    Description: epitope description:NFELCDNPFFAVSKPMG antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  87. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1133

    Description: epitope description:FFAVSKPMGTQTHTMIF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  88. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1139

    Description: epitope description:THTMIFDNAFNCTFEYI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  89. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1142

    Description: epitope description:NAFNCTFEYISDAFSLD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  90. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1160

    Description: epitope description:YQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  91. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1161

    Description: epitope description:YQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  92. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1167

    Description: epitope description:LKPIFKLPLGINITNFR antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  93. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1180

    Description: epitope description:WGTSAAAYFVGYLKPTT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  94. Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution...

    ID: 14

    Description: epitope description:F37, G38, K61, E62, E63, A97, K100, K101, N104, E105 antigen name:Cytochrome c host organism:Mus musculus BALB/c antibody name:E8

    Publication: 9698550;

  95. The crystal structure of human angiogenin in complex with an antitumor neutralizing antibody.

    ID: 32

    Description: epitope description:G58, L59, S61, P62, C63, K64, D65, G109, G110, S111, P112, W113, P114, P115 antigen name:Angiogenin host organism:Mus musculus BAL...

    Publication: 12842050;

  96. Epitope mapping and features of the epitope for monoclonal antibodies inhibiting enzymatic activity of Helicobacter pylori urease.

    ID: 220

    Description: epitope description:IFGFNALVDR antigen name:Urease subunit alpha host organism:Oryctolagus cuniculus

    Publication: 15112296;

  97. Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

    ID: 341

    Description: epitope description:EESFLRSAEA antigen name:Ses i 2 host organism:Homo sapiens

    Publication: 15536424;

  98. Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

    ID: 343

    Description: epitope description:SFLRSAEANQ antigen name:Ses i 2 host organism:Homo sapiens

    Publication: 15536424;

  99. Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

    ID: 344

    Description: epitope description:LRSAEANQG antigen name:Ses i 2 host organism:Homo sapiens

    Publication: 15536424;

  100. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10248

    Description: epitope description:RYRQYINS antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston