Serum and mucosal antibodies of infected foals recognized two distinct epitopes of VapA of Rhodococcus equi.

ID: 1463126

Description: epitope description:VSFQYNAVGPYLNINFFDSS antigen name:Virulence associated protein VapA host organism:Equus caballus antibody name:Horse serum

Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

ID: 1416696

Description: epitope description:VVERLGDYLLEQGM antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

ID: 1415780

Description: epitope description:IPKVPPGPNITATYGDKWLDAKSTWYGKPTG antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 3

Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

ID: 1415781

Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 4

Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

ID: 1415782

Description: epitope description:VRYTTEGGTKTEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 5