Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484480

    Description: epitope description:EVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  2. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484481

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  3. Fine mapping of canine parvovirus B cell epitopes.

    ID: 1484483

    Description: epitope description:GQPAVRNERATGS antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1919526;

  4. Helper T-cell determinants in vaccine design.

    ID: 1484494

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2476143;

  5. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484517

    Description: epitope description:VPNLRGDLQVLAQKVART antigen name:Genome polyprotein host organism:Ovis aries

    Publication: 1690176;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston