Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483188

    Description: epitope description:FLPWKAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  2. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483189

    Description: epitope description:FLPWRAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  3. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483228

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  4. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483232

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  5. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483264

    Description: epitope description:SLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  6. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483290

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  7. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483292

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  8. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483331

    Description: epitope description:IVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLN antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 9609528;

  9. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483334

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 9609528;

  10. Cross-reactivity between immunodominant human T lymphotropic virus type I tax and neurons: implications for molecular mimicry.

    ID: 1483367

    Description: epitope description:KHFRETEV antigen name:Protein Tax-1 host organism:Mus musculus antibody name:Tab169, Tab 170, Tab 171

    Publication: 12404172;

  11. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483378

    Description: epitope description:PFFFSDVRSNFSKLV antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  12. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483393

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  13. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483405

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  14. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483411

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  15. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483415

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  16. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483417

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  17. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483419

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  18. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483421

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  19. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483426

    Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  20. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483447

    Description: epitope description:GSNDDLWHQWKRMYNKEYN antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  21. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483456

    Description: epitope description:NNRDVPASIDWREYGYVTE antigen name:Cathepsin L-like proteinase host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  22. The p12I, p13II, and p30II proteins encoded by human T-cell leukemia/lymphotropic virus type I open reading frames I and II are localized in three dif...

    ID: 1483458

    Description: epitope description:GGPRRSRPRLSSSKDSK antigen name:Accessory protein p30II host organism:Oryctolagus cuniculus

    Publication: 8445734;

  23. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483467

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;

  24. Protection against measles virus-induced encephalitis by anti-mimotope antibodies: the role of antibody affinity.

    ID: 1483480

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10873752;

  25. Protection against measles virus-induced encephalitis by anti-mimotope antibodies: the role of antibody affinity.

    ID: 1483481

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10873752;

  26. Intrinsic immunogenicity of an internal VP1 T-B epitope pair of type 1 poliovirus.

    ID: 1483500

    Description: epitope description:RSRSESSIESF antigen name:Genome polyprotein host organism:Mus musculus SJL antibody name:anti-VP1 (70-80)

    Publication: 1280759;

  27. A modified TMV-based vector facilitates the expression of longer foreign epitopes in tobacco.

    ID: 1483515

    Description: epitope description:PNLRGDLQVLA antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16337317;

  28. Biosensor characterization of antigenic site A of foot-and-mouth disease virus presented in different vector systems.

    ID: 1484451

    Description: epitope description:YTASARGDLAHLTTTHARHLPTSF + ACET(Y1) antigen name:Genome polyprotein host organism:Mus musculus antibody name:3E5

    Publication: 9684999;

  29. Biosensor characterization of antigenic site A of foot-and-mouth disease virus presented in different vector systems.

    ID: 1484460

    Description: epitope description:YTASARGDLAHLTTTHARHLPTSF + ACET(Y1) antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 9684999;

  30. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484478

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  31. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484480

    Description: epitope description:EVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  32. Detection of antibodies to human T-lymphotropic virus type I by using synthetic peptides.

    ID: 1484481

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2185995;

  33. Fine mapping of canine parvovirus B cell epitopes.

    ID: 1484483

    Description: epitope description:GQPAVRNERATGS antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1919526;

  34. Helper T-cell determinants in vaccine design.

    ID: 1484494

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2476143;

  35. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484517

    Description: epitope description:VPNLRGDLQVLAQKVART antigen name:Genome polyprotein host organism:Ovis aries

    Publication: 1690176;

  36. Enzyme immunoassay with synthetic peptides to detect anti-HTLV-I antibodies.

    ID: 1484525

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1582023;

  37. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484530

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:3E4, 5E11, 4C6-D6, 4C6-E5, 1C9, 7G7, 5D5, 5D9, 5F8...

    Publication: 1690176;

  38. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484531

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:5D9, 5F8, 6B6, 2E6, 6C11, 4C6-E5

    Publication: 1690176;

  39. A hemagglutinin-derived peptide-vaccine ignored by virus-neutralizing passive antibodies, protects against murine measles encephalitis.

    ID: 1484532

    Description: epitope description:YAMGVGVELE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10392626;

  40. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484535

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries antibody name:2E6, 6C11

    Publication: 1690176;

  41. Analysis of immune responses in the sheep to synthetic peptides of foot-and-mouth disease virus using ovine polyclonal and monoclonal antibodies.

    ID: 1484539

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries

    Publication: 1690176;

  42. A hemagglutinin-derived peptide-vaccine ignored by virus-neutralizing passive antibodies, protects against murine measles encephalitis.

    ID: 1484559

    Description: epitope description:RSELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 10392626;

  43. The molecular basis of virus crossreactivity and neutralisation after immunisation with optimised chimeric peptides mimicking a putative helical epito...

    ID: 1484563

    Description: epitope description:KPNLSSKRSELSQLSMYRVF antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 9881686;

  44. Monoclonal antibodies against measles virus haemagglutinin react with synthetic peptides.

    ID: 1484565

    Description: epitope description:NPDREYDFRD antigen name:Hemagglutinin glycoprotein host organism:Mus musculus antibody name:48

    Publication: 2474850;

  45. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484616

    Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

    Publication: 17012909;

  46. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484617

    Description: epitope description:KPIVQYDNF antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus Ne...

    Publication: 17012909;

  47. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484630

    Description: epitope description:SSPSSTKSSSPSNVKSAS antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody ...

    Publication: 17012909;

  48. Development, characterization and immunogenicity of a multi-stage, multi-valent Plasmodium falciparum vaccine antigen (FALVAC-1A) expressed in Escheri...

    ID: 1484631

    Description: epitope description:LATRLMKKFKAEIRDFF antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody n...

    Publication: 17012909;

  49. Lymphocyte recognition elements on the VP1 protein of Theiler's virus.

    ID: 1484638

    Description: epitope description:VDFVAEPVKLPENQT antigen name:Cardiovirus B protein host organism:Mus musculus CBA

    Publication: 7543873;

  50. Lymphocyte recognition elements on the VP1 protein of Theiler's virus.

    ID: 1484659

    Description: epitope description:LPSFCPDSSSGPQKT antigen name:Cardiovirus B protein host organism:Mus musculus CBA

    Publication: 7543873;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston