Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Fixed expression of single influenza virus-specific TCR chains demonstrates the capacity for TCR alpha- and beta-chain diversity in the face of peptid...

    ID: 3467711

    Description: epitope description:SSLENFRAYV antigen name:Polymerase acidic protein host organism:Mus musculus 6218 TCR Tg t cell receptor:PAbeta 6218 TCR mhc allel...

    Publication: 25535284;

  2. Induction of diabetes in standard mice by immunization with the p277 peptide of a 60-kDa heat shock protein.

    ID: 3467743

    Description: epitope description:VLGGGCALLRCIPALDSLTPANED antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus C57BL/6...

    Publication: 7589082;

  3. Induction of diabetes in standard mice by immunization with the p277 peptide of a 60-kDa heat shock protein.

    ID: 3467747

    Description: epitope description:VLGGGCALLRCIPALDSLTPANED antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus C57BL/6

    Publication: 7589082;

  4. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467977

    Description: epitope description:HLVEALYLV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-A*02:01

    Publication: 28794283;

  5. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467980

    Description: epitope description:GSLQPLALEGSLQKRGIV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-A*02:01

    Publication: 28794283;

  6. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467982

    Description: epitope description:GSLQPLALEGSLQKRGIV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-DRB1*04:01

    Publication: 28794283;

  7. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467991

    Description: epitope description:GEPGIAGFKGEQGPKGEPGP + HYL(P3, P18) antigen name:Collagen alpha-1(II) chain host organism:Mus musculus qCII24 TCR Tg mhc allele na...

    Publication: 27837109;

  8. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467995

    Description: epitope description:GEPGAPGNKGEQGPKGEPGP + HYL(P3, P6, P18) host organism:Mus musculus qCII24 TCR Tg mhc allele name:H2-IAq

    Publication: 27837109;

  9. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467998

    Description: epitope description:GEPGAPGNKGEQGPKGEPGP + HYL(P3, P6, P18) host organism:Mus musculus qCII24 TCR Tg mhc allele name:H2-IAq

    Publication: 27837109;

  10. Repertoire dynamics of autoreactive T cells in multiple sclerosis patients and healthy subjects: epitope spreading versus clonal persistence.

    ID: 3468012

    Description: epitope description:ENPVVHFFKNIVTPR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens mhc allele name:HLA-DRB3*02:02

    Publication: 10686174;

  11. NY-ESO-1 TCR single edited stem and central memory T cells to treat multiple myeloma without graft-versus-host disease.

    ID: 3468059

    Description: epitope description:SLLMWITQC antigen name:Cancer/testis antigen 1 host organism:Homo sapiens t cell receptor:IG4 mhc allele name:HLA-A*02:01

    Publication: 28637663;

  12. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468128

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6 mhc allele name:H2-b cla...

    Publication: 16506290;

  13. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468143

    Description: epitope description:MEVGWYRSPFARVVHL host organism:Mus musculus C57BL/6 t cell receptor:32.2 mhc allele name:H2-IAb

    Publication: 16506290;

  14. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468150

    Description: epitope description:MEAGWYRSPFSRVVHL host organism:Mus musculus C57BL/6 t cell receptor:32.2 mhc allele name:H2-IAb

    Publication: 16506290;

  15. Tackling Bet v 1 and associated food allergies with a single hybrid protein.

    ID: 3468209

    Description: epitope description:NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQV antigen name:Bet v 1 host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 27939703;

  16. Structural and kinetic basis for heightened immunogenicity of T cell vaccines.

    ID: 3468275

    Description: epitope description:SLLMWITQV host organism:Homo sapiens t cell receptor:1G4 mhc allele name:HLA-A*02:01

    Publication: 15837811;

  17. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468293

    Description: epitope description:VMAQDKPTVDIELVT antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  18. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468298

    Description: epitope description:RLKGVSYSLCTAAFTF antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  19. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468300

    Description: epitope description:TMNNKHWLVHKEWFH antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  20. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468309

    Description: epitope description:RLITANPVITESTEN antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston