Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A Japanese encephalitis virus peptide present on Johnson grass mosaic virus-like particles induces virus-neutralizing antibodies and protects mice aga...

    ID: 16231

    Description: epitope description:GRGDKQINHHWHKA antigen name:Genome polyprotein host organism:Mus musculus FVB/J

    Publication: 12610124;

  2. Immune response to synthetic peptides of dengue prM protein.

    ID: 16265

    Description: epitope description:CEDTITYKCPLLRQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11906771;

  3. Immune response to synthetic peptides of dengue prM protein.

    ID: 16273

    Description: epitope description:RQNEPEDIDCWCNSTSTWVTYGTCTTTGEHRREKRS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 11906771;

  4. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16295

    Description: epitope description:MSTLQELQENITA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  5. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16296

    Description: epitope description:HEQQLVTARQKLK antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  6. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16311

    Description: epitope description:NSIDLEEPSGQTA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  7. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16313

    Description: epitope description:DWKAIGAYILGFA antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  8. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16316

    Description: epitope description:RGRQAVKDNKGTRIRFKDDSSFEEVN antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  9. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16318

    Description: epitope description:GIRKPKHLYVSMP antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  10. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16322

    Description: epitope description:GRFRTIACGLFPA antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston