Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15137

    Description: epitope description:PEKQRTPQDN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;
  2. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15139

    Description: epitope description:QLTYVVIAIL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;
  3. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15243

    Description: epitope description:PSSKRFQPFQQFGRDVSDFT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;
  4. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15255

    Description: epitope description:YKGYQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;
  5. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15258

    Description: epitope description:TDAVDCSQNPLAELKCSVKSF antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;
  6. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15305

    Description: epitope description:PSSKRFQPFQQFGRDVSDFTDSVRDPKTSE antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15811330;
  7. Novel human monoclonal antibody combination effectively neutralizing natural rabies virus variants and individual in vitro escape mutants.

    ID: 15349

    Description: epitope description:KLCGVL antigen name:Glycoprotein host organism:Homo sapiens

    Publication: 15994800;
  8. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14129

    Description: epitope description:MEEKATYVHKKNDGTTVDLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;
  9. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14132

    Description: epitope description:KNDGTTVDLTVDQAWRGKGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;
  10. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14133

    Description: epitope description:RGKGEGLPGMCGGALVSSNQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

Displaying 10 of 1,510,353 results for " "