Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13637

    Description: epitope description:NRLTSPSNVASHVRVNVYLS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  2. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13638

    Description: epitope description:SAINLECFAPLYHAMDVTTQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  3. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13639

    Description: epitope description:MDVTTQVGDDSGGFSTTVST antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  4. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13655

    Description: epitope description:VDGMAWFTPVGLAVDTPWVE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  5. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13662

    Description: epitope description:AVRFNTRRTGNIQIRLPWYS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  6. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13665

    Description: epitope description:YSYLYAVSGALDGLGDKTDS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  7. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13668

    Description: epitope description:LDGLGDKTDSTFGLVSIQIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  8. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13671

    Description: epitope description:SIQIANYNHSDEYLSFSCYL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  9. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13679

    Description: epitope description:TEEHEIMKFSWRGVTADTRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  10. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13680

    Description: epitope description:TADTRALRRFGFSLAAGRSV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  11. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13681

    Description: epitope description:LAAGRSVWTLEMDAGVLTGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  12. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13682

    Description: epitope description:MDAGVLTGRLIRLNDEKWTE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  13. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13683

    Description: epitope description:LNDEKWTEMKDDKIVSLIEK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  14. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13696

    Description: epitope description:MLETVFNWQMDSRMMELRTQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  15. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13703

    Description: epitope description:MAQVDPNLMVHLSPLRDCIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  16. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13704

    Description: epitope description:ARVHQKLKNLGSINQAMVTR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  17. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13707

    Description: epitope description:GVEPEKNIYTKPVASDYWDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  18. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13723

    Description: epitope description:LEEKGRHFSSPFIIATSNWS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  19. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13733

    Description: epitope description:GGWFVYKHFSRKEEEPIPAE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  20. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13742

    Description: epitope description:LVPSHAYKFEKDYEMMEFYF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  21. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13779

    Description: epitope description:NRGGTYYSISAGNVVIQSLD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  22. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13780

    Description: epitope description:VIQSLDVGFQDVVLMKVPTI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  23. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13791

    Description: epitope description:GIHVAGGNSILVAKLVTQEM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  24. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13811

    Description: epitope description:LPIVEEPEDYKEASIFYQNK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  25. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13812

    Description: epitope description:EPEDYKEASIFYQNKIVGKT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  26. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13814

    Description: epitope description:DLDMAITGAPGIDAINMDSS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  27. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13816

    Description: epitope description:NMDSSPGFPYVQEKLTKRDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  28. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13819

    Description: epitope description:MENCSDLDVVFTTCPKDELR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  29. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13839

    Description: epitope description:DACPLDYSILCRMYWGPAIS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  30. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13843

    Description: epitope description:LNPGFHTGVAIGIDPDRQWD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  31. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13844

    Description: epitope description:TGVAIGIDPDRQWDELFKTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  32. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13846

    Description: epitope description:MIREAGRIMSELSGTPSHFG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  33. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13847

    Description: epitope description:SGTPSHFGTALINTIIYSKH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  34. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13858

    Description: epitope description:KIFGKSPVFFCQALKILCYG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  35. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13876

    Description: epitope description:LKRSFNLVEDRIRPAISEKT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  36. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13884

    Description: epitope description:KSYDWWRMRFYDQCFICDLS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  37. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13956

    Description: epitope description:DKPGSKKTQGEKFFLIHSAD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  38. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 13974

    Description: epitope description:INPTPFQQGGLICAMVPGDQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  39. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14588

    Description: epitope description:DVKTSA antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  40. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14592

    Description: epitope description:SAEGQL antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  41. Finer mapping of neutralizing epitope(s) on the C-terminal of Japanese encephalitis virus E-protein expressed in recombinant Escherichia coli system.

    ID: 14643

    Description: epitope description:EAHNEKRADSSYVCKQGFTDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus C3H/He

    Publication: 8578835;

  42. Finer mapping of neutralizing epitope(s) on the C-terminal of Japanese encephalitis virus E-protein expressed in recombinant Escherichia coli system.

    ID: 14644

    Description: epitope description:EAHNEKRADSSYVCKQGFTDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus C3H/He

    Publication: 8578835;

  43. Recombinant antibodies containing an engineered B-cell epitope capable of eliciting conformation-specific antibody responses.

    ID: 14647

    Description: epitope description:SKRGPGSGF host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8701592;

  44. Recombinant antibodies containing an engineered B-cell epitope capable of eliciting conformation-specific antibody responses.

    ID: 14651

    Description: epitope description:SKRGPGSGF host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8701592;

  45. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14660

    Description: epitope description:LTLSIDLP antigen name:Listeriolysin O host organism:Mus musculus antibody name:M275

    Publication: 8675351;

  46. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14661

    Description: epitope description:LTLSIDLP antigen name:Listeriolysin O host organism:Mus musculus antibody name:M275

    Publication: 8675351;

  47. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14665

    Description: epitope description:LTLSIDLP antigen name:Listeriolysin O host organism:Mus musculus antibody name:M344

    Publication: 8675351;

  48. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14672

    Description: epitope description:WNEKYAQ antigen name:Listeriolysin O host organism:Mus musculus antibody name:S179

    Publication: 8675351;

  49. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14676

    Description: epitope description:GKAVTKEQL antigen name:Listeriolysin O host organism:Mus musculus antibody name:S153

    Publication: 8675351;

  50. Neutralizing monoclonal antibodies against listeriolysin: mapping of epitopes involved in pore formation.

    ID: 14679

    Description: epitope description:GKAVTKEQL antigen name:Listeriolysin O host organism:Mus musculus antibody name:S153

    Publication: 8675351;

  51. Highly glycosylated human salivary molecules present oligosaccharides that mediate adhesion of leukocytes and Helicobacter pylori.

    ID: 14799

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-[alpha-L-Fuc-(1->4)]-D-GlcNAc antigen name:Mucin-5B host organism:Mus musculus antibody name...

    Publication: 15697247;

  52. Highly glycosylated human salivary molecules present oligosaccharides that mediate adhesion of leukocytes and Helicobacter pylori.

    ID: 14802

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcNAc antigen name:Mucin-5B host organism:Mus musculus antibody na...

    Publication: 15697247;

  53. A single amino acid is critical for the expression of B-cell epitopes on the helicase domain of the pestivirus NS3 protein.

    ID: 14923

    Description: epitope description:L271 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:P1D8

    Publication: 11900844;

  54. A synthetic peptide based on the NS1 non-structural protein of tick-borne encephalitis virus induces a protective immune response against fatal enceph...

    ID: 14971

    Description: epitope description:RGGIPSLLKKGKDIKV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 16022903;

  55. A synthetic peptide based on the NS1 non-structural protein of tick-borne encephalitis virus induces a protective immune response against fatal enceph...

    ID: 14990

    Description: epitope description:VAEFGVGLRTKVFLDFRQESTHECDTG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 16022903;

  56. A synthetic peptide based on the NS1 non-structural protein of tick-borne encephalitis virus induces a protective immune response against fatal enceph...

    ID: 14998

    Description: epitope description:VTINADCDKRGASVRSTTESGKV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 16022903;

  57. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15048

    Description: epitope description:KKARNTPFNM antigen name:Genome polyprotein host organism:Mus musculus antibody name:Hyperimmune mouse sera

    Publication: 16022901;

  58. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15053

    Description: epitope description:ARNTPFNMLK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  59. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15058

    Description: epitope description:TPFNMLKRER antigen name:Genome polyprotein host organism:Mus musculus antibody name:Hyperimmune mouse sera

    Publication: 16022901;

  60. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15063

    Description: epitope description:FNMLKRERNR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  61. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15073

    Description: epitope description:AGILKRWGTI antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  62. A common neutralizing epitope conserved between the hemagglutinins of influenza A virus H1 and H2 strains.

    ID: 15089

    Description: epitope description:T30, G31, L32, R33, N34, G88, I89, T90, N91, K92, V93, N94, S95, V96, I97, E98, K99 antigen name:Hemagglutinin host organism:Mus m...

    Publication: 7682624;

  63. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15108

    Description: epitope description:TEMGRLPTFM antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  64. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15111

    Description: epitope description:GRLPTFMTQK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  65. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15112

    Description: epitope description:RLPTFMTQKA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  66. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15115

    Description: epitope description:KARDALDNLA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  67. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15118

    Description: epitope description:RDALDNLAVL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  68. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15119

    Description: epitope description:DALDNLAVLH antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  69. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15131

    Description: epitope description:TVTGGIFLFL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  70. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15135

    Description: epitope description:HWIAASIILE antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  71. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15137

    Description: epitope description:PEKQRTPQDN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  72. The identification of immunodominant linear epitopes of dengue type 2 virus capsid and NS4a proteins using pin-bound peptides.

    ID: 15139

    Description: epitope description:QLTYVVIAIL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Pooled human sera

    Publication: 16022901;

  73. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15243

    Description: epitope description:PSSKRFQPFQQFGRDVSDFT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;

  74. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15255

    Description: epitope description:YKGYQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;

  75. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15258

    Description: epitope description:TDAVDCSQNPLAELKCSVKSF antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15811330;

  76. Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

    ID: 15305

    Description: epitope description:PSSKRFQPFQQFGRDVSDFTDSVRDPKTSE antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15811330;

  77. Novel human monoclonal antibody combination effectively neutralizing natural rabies virus variants and individual in vitro escape mutants.

    ID: 15349

    Description: epitope description:KLCGVL antigen name:Glycoprotein host organism:Homo sapiens

    Publication: 15994800;

  78. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14129

    Description: epitope description:MEEKATYVHKKNDGTTVDLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  79. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14132

    Description: epitope description:KNDGTTVDLTVDQAWRGKGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  80. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14133

    Description: epitope description:RGKGEGLPGMCGGALVSSNQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  81. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14136

    Description: epitope description:VAKLVTQEMFQNIDKKIESQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  82. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14138

    Description: epitope description:RIMKVEFTQCSMNVVSKTLF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  83. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14154

    Description: epitope description:DLDFSAFDASLSPFMIREAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  84. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14158

    Description: epitope description:LGMTATSADKNVPQLKPVSE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  85. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14163

    Description: epitope description:WQRSNAEFEQNLENAQWFAF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  86. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14164

    Description: epitope description:WQRSNAEFEQNLENAQWFAF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  87. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 14170

    Description: epitope description:SETNKNPTSHSNSTTTSLNNN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  88. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 14171

    Description: epitope description:LNNNILGWEFGGGAPQNGAAEDKKTEY antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  89. Anti-class II monoclonal antibody-targeted Vibrio cholerae TcpA pilin: modulation of serologic response, epitope specificity, and isotype.

    ID: 14199

    Description: epitope description:AETGVGVIKSIAPASKNLDLTNITH antigen name:UniProt:A5F392 host organism:Mus musculus CBA/J

    Publication: 11705948;

  90. Localization of a sequential B-epitope in the VP2 protein of hepatitis A virus.

    ID: 14445

    Description: epitope description:STSNPPHGLPSTLRWFFNLFQLYRG antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 7541374;

  91. Localization of a sequential B-epitope in the VP2 protein of hepatitis A virus.

    ID: 14449

    Description: epitope description:AQFPFNASDSVGQQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7541374;

  92. Localization of a sequential B-epitope in the VP2 protein of hepatitis A virus.

    ID: 14451

    Description: epitope description:FPFNASDSVGQQIKVIP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7541374;

  93. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14564

    Description: epitope description:ASFDAD antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  94. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14569

    Description: epitope description:IRIAQP antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  95. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14579

    Description: epitope description:TTLNPT antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  96. Immunologic characterization of a cloned fragment containing the species-specific epitope from the major outer membrane protein of Chlamydia trachomat...

    ID: 14585

    Description: epitope description:GAGDVK antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1701415;

  97. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14001

    Description: epitope description:SDSVGQQIKVIPVDPYFFQM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  98. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14015

    Description: epitope description:VASHVRVNVYLSAINLECFA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  99. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14018

    Description: epitope description:QNVPDPQVGITTMKDLKGKA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  100. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14022

    Description: epitope description:ITTIEDPVLAKKVPETFPEL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston