Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485374

    Description: epitope description:TSPEGNPSPSQV antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  2. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485376

    Description: epitope description:PSPSQVYTTSEY antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  3. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485379

    Description: epitope description:SEYPSQPPSPSN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  4. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485380

    Description: epitope description:PSQPPSPSNTTN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  5. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485381

    Description: epitope description:SQPTSPSNITNQ antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  6. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485382

    Description: epitope description:DHKPQTTKPKEA antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  7. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485385

    Description: epitope description:KEAPTTKPTEKP antigen name:Attachment glycoprotein (G) host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  8. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485392

    Description: epitope description:RTTLLTNSTTGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  9. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485393

    Description: epitope description:LLTNSTTGNLEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  10. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485436

    Description: epitope description:EETLHSTSSEGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  11. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485438

    Description: epitope description:YTTSEYPSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  12. Bacterially expressed antigenic peptide from foot-and-mouth disease virus capsid elicits variable immunologic responses in animals.

    ID: 1485479

    Description: epitope description:PNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus CBA

    Publication: 3005401;

  13. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485491

    Description: epitope description:NSTTGNLEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  14. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485496

    Description: epitope description:SNTTRNPEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  15. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485503

    Description: epitope description:NSTTGNLEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  16. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485504

    Description: epitope description:NNTTGNPEH antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  17. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485507

    Description: epitope description:NNTTGYLEL antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  18. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485511

    Description: epitope description:LHSTSSEGN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  19. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485522

    Description: epitope description:SEYQSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  20. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485524

    Description: epitope description:SEYLSQPPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  21. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485525

    Description: epitope description:SEYLSQPTS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  22. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485528

    Description: epitope description:SEYLSQTPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  23. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485529

    Description: epitope description:SEYLSQPLS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  24. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485533

    Description: epitope description:FEYLSQSPS antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  25. Bacterially expressed antigenic peptide from foot-and-mouth disease virus capsid elicits variable immunologic responses in animals.

    ID: 1485534

    Description: epitope description:PNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus A/J

    Publication: 3005401;

  26. Analysis of linear epitopes recognised by the primary human antibody response to a variable region of the attachment (G) protein of respiratory syncyt...

    ID: 1485535

    Description: epitope description:FHSTSSESN antigen name:Major surface glycoprotein G host organism:Homo sapiens antibody name:Infant sera

    Publication: 9093944;

  27. Production and characteristics of strain common antibodies against a synthetic polypeptide corresponding to the C-terminal region of potato virus Y co...

    ID: 1485540

    Description: epitope description:HTTEDVSPSMHTLLGVKNM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1474133;

  28. Structural comparison between retro-inverso and parent peptides: molecular basis for the biological activity of a retro-inverso analogue of the immuno...

    ID: 1485549

    Description: epitope description:GSGVRGDSGSLALRVARQL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 9095678;

  29. Structural comparison between retro-inverso and parent peptides: molecular basis for the biological activity of a retro-inverso analogue of the immuno...

    ID: 1485550

    Description: epitope description:GSGVRGDSGSLALRVARQL antigen name:Polyprotein host organism:Cavia porcellus

    Publication: 9095678;

  30. Epitope mapping by cysteine mutagenesis: identification of residues involved in recognition by three monoclonal antibodies directed against LamB glyco...

    ID: 1485555

    Description: epitope description:T336, D379, G382, D385, N387, N389, K392, F398 antigen name:Maltoporin host organism:Mus musculus BALB/c antibody name:302

    Publication: 7521310;

  31. Human T-lymphotropic virus type 1 peptides in chimeric and multivalent constructs with promiscuous T-cell epitopes enhance immunogenicity and overcome...

    ID: 1485573

    Description: epitope description:PHWTKKPNRNGGGYYSASYSDP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7545241;

  32. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485848

    Description: epitope description:DVAGLEKDPVA host organism:Mus musculus antibody name:A-20

    Publication: 2453883;

  33. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485850

    Description: epitope description:DVAGLEKDPVA host organism:Mus musculus antibody name:A-20

    Publication: 2453883;

  34. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485853

    Description: epitope description:DNENHATVSDSKLV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-45

    Publication: 2453883;

  35. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485858

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-5

    Publication: 2453883;

  36. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485859

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-5

    Publication: 2453883;

  37. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485860

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  38. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485861

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  39. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485862

    Description: epitope description:FDVTTLNPTIAGAGDVK antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:DIII-A3

    Publication: 2453883;

  40. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485864

    Description: epitope description:SATTVFDVTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-10

    Publication: 2453883;

  41. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485865

    Description: epitope description:SATTVFDVTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-10

    Publication: 2453883;

  42. Development of human antibodies against linear antigenic and immunogenic regions of respiratory syncytial virus (RSV) nucleocapsid and phospho-protein...

    ID: 1485883

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens antibody name:Paired Human Sera

    Publication: 9785215;

  43. Synthetic immunogens constructed from T-cell and B-cell stimulating peptides (T:B chimeras): preferential stimulation of unique T- and B-cell specific...

    ID: 1485998

    Description: epitope description:CEYNVFHNKTFELPRA antigen name:Small hydrophobic protein (SH) host organism:Mus musculus SJL

    Publication: 1688404;

  44. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486159

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  45. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486160

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  46. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486161

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  47. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486183

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  48. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486188

    Description: epitope description:TQHPENQPQQRV host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  49. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486224

    Description: epitope description:INIDSNPLHHLL host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  50. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486232

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston