Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

ID: 1486426

Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

Virus-specific CTL responses induced by an H-2K(d)-restricted, motif-negative 15-mer peptide from the fusion protein of respiratory syncytial virus.

ID: 1486434

Description: epitope description:ELQLLMQSTPPTNNR antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:Mouse sera

Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

ID: 1486468

Description: epitope description:S23 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.30, 1.44

Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

ID: 1486492

Description: epitope description:YGPGVDY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.29

Identification of a T-cell epitope adjacent to neutralization antigenic site 1 of poliovirus type 1.

ID: 1486527

Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Mus musculus BALB/c