Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14024

    Description: epitope description:EDPVLAKKVPETFPELKPGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  2. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14029

    Description: epitope description:FPELKPGESRHTSDHMSIYK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  3. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14031

    Description: epitope description:DHMSIYKFMGRSHFLCTFTF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  4. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14033

    Description: epitope description:HFLCTFTFNSNNKEYTFPIT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  5. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14035

    Description: epitope description:TPVGLAVDTPWVEKESALSI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  6. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14040

    Description: epitope description:MSRIAAGDLESSVDDPRSEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  7. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14047

    Description: epitope description:SHIECRKPYKELRLEVGKQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  8. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14049

    Description: epitope description:PYKELRLEVGKQRLKYAQEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  9. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14051

    Description: epitope description:QRLKYAQEELSNEVLPPPRK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  10. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14053

    Description: epitope description:VLPPPRKMKGLFSQAKISLF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  11. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14060

    Description: epitope description:LGSINQAMVTRCEPVVCYLY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  12. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14096

    Description: epitope description:RCEPVVCYLYGKRGGGKSLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  13. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14100

    Description: epitope description:VSGCPMRLNMASLEEKGRHF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  14. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14116

    Description: epitope description:DSAVAEFFQSFPSGEPSNSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  15. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14121

    Description: epitope description:GLVRKNLVQFGVGEKNGCVR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  16. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17539

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  17. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17541

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  18. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17555

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  19. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17558

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  20. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17563

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  21. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17568

    Description: epitope description:ILSALEIPDVGNLSQVVVM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  22. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17575

    Description: epitope description:NKCKMNLQDNNGNDIGFIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  23. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17576

    Description: epitope description:NKCKMNLQDNNGNDIGFIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  24. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17582

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  25. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17587

    Description: epitope description:SRTLGCSWEFIPVDDGWGE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  26. Development of a humanized monoclonal antibody with therapeutic potential against West Nile virus.

    ID: 17594

    Description: epitope description:S592, K593, T616, T618 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:Humanized E16.3

    Publication: 15852016;

  27. Differential expression of domain III neutralizing epitopes on the envelope proteins of West Nile virus strains.

    ID: 17675

    Description: epitope description:K310, L312, T332, A365 antigen name:Genome polyprotein host organism:Mus musculus antibody name:5H10, 5C5, 7H2

    Publication: 15823609;

  28. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17696

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-...

    Publication: 12183547;

  29. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17697

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-...

    Publication: 12183547;

  30. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17719

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetyl...

    Publication: 12183547;

  31. Identification of Genogroup I and Genogroup II broadly reactive epitopes on the norovirus capsid.

    ID: 17797

    Description: epitope description:E472, K514 antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:NV3901, NV3912

    Publication: 15919896;

  32. Antibody responses against wild-type yellow fever virus and the 17D vaccine strain: characterization with human monoclonal antibody fragments and neut...

    ID: 17849

    Description: epitope description:N71, T153, T154, D155 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:scFv-7A

    Publication: 15919103;

  33. Autoantigenicity of DFS70 is restricted to the conformational epitope of C-terminal alpha-helical domain.

    ID: 18047

    Description: epitope description:TEISLKDS antigen name:PC4 and SFRS1-interacting protein host organism:Homo sapiens antibody name:anti-DFS70 Ab

    Publication: 15501393;

  34. Synthesis and immunochemical characterization of protein conjugates of carbohydrate and carbohydrate-mimetic peptides as experimental vaccines.

    ID: 18244

    Description: epitope description:S. flexneri Y polysaccharide antigen name:lipopolysaccharide host organism:Mus musculus antibody name:SYA/J6

    Publication: 15186860;

  35. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18255

    Description: epitope description:TEAAILTQQAAQFDQ antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  36. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18271

    Description: epitope description:QAASAALGALGRFDE antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  37. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18280

    Description: epitope description:SIVDKLNRSGGNYTK antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  38. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18282

    Description: epitope description:LNRSGGNYTKTDDEA antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  39. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18294

    Description: epitope description:MAEMKTDAATLAQEA antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  40. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18307

    Description: epitope description:LAQEAGNFERISGDL antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  41. MUC1 mucin-mediated regulation of human T cells.

    ID: 18325

    Description: epitope description:APDTR antigen name:Mucin-1 host organism:Mus musculus CBA X BALB/c antibody name:BC3 anti-MUC1 Ab

    Publication: 15710907;

  42. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18338

    Description: epitope description:KTQIDQVESTAGSLQ antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  43. MUC1 mucin-mediated regulation of human T cells.

    ID: 18339

    Description: epitope description:APDTRP antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:SM3 anti-MUC1 Ab

    Publication: 15710907;

  44. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18357

    Description: epitope description:AAGTAAQAAVVRFQE antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  45. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18371

    Description: epitope description:VRFQEAANKQKQELD antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  46. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18379

    Description: epitope description:KQELDEISTNIRQAG antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  47. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18389

    Description: epitope description:VQYSRADEEQQQALS antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  48. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16404

    Description: epitope description:YIIGSTELGLISI antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  49. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16410

    Description: epitope description:KLESSCNFDLHTT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  50. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16412

    Description: epitope description:FDLHTTSMAQKSFTQVEWRKKSDTTDTTNAASTTFEAQT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  51. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16418

    Description: epitope description:LCYDLTCNQTHCQ antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  52. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16419

    Description: epitope description:LCYDLTCNQTHCQ antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  53. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16425

    Description: epitope description:SIRSCMARVFTSR antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  54. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16427

    Description: epitope description:ARVFTSRIQVIYE antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  55. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16429

    Description: epitope description:IQVIYEKTHCVTG antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  56. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16435

    Description: epitope description:CFNPAHTLTLSQP antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  57. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16440

    Description: epitope description:TLPISCFFTPKES antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  58. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16443

    Description: epitope description:FFTPKESEQLKVIKTFEGIL antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  59. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16444

    Description: epitope description:KTFEGILTKTGCT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  60. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16449

    Description: epitope description:ENALQGYYVCFLG antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  61. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16451

    Description: epitope description:YVCFLGSHSEPLI antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  62. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16459

    Description: epitope description:SRMLVHPRGEDHD antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  63. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16479

    Description: epitope description:SSPTCLVNKVQRF antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  64. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16481

    Description: epitope description:RGSEQKINFICQR antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  65. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16495

    Description: epitope description:VAHSLAVELCVPG antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  66. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16502

    Description: epitope description:HYTNESKFKFILE antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  67. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16503

    Description: epitope description:HYTNESKFKFILE antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  68. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16505

    Description: epitope description:KVKVEYQKTMGSM antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  69. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16507

    Description: epitope description:VCDVCHHECETAK antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  70. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16510

    Description: epitope description:CPYCMTITEATES antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  71. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16511

    Description: epitope description:CPYCMTITEATES antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  72. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16518

    Description: epitope description:RYKSRCYVGLVWC antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  73. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16531

    Description: epitope description:SSSSYSYRRKLTN antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  74. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16532

    Description: epitope description:RRKLTNPANKEES antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  75. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16538

    Description: epitope description:MEKQVIHAEIQPL antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  76. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16546

    Description: epitope description:QKYSYPWQTSKCF antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  77. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16547

    Description: epitope description:QKYSYPWQTSKCF antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  78. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16557

    Description: epitope description:KAYKIISLKYTRK antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  79. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16558

    Description: epitope description:VCIQLGTEQTCKH antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  80. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16570

    Description: epitope description:MSTPSGMRCPEHT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  81. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16583

    Description: epitope description:SGYKRMMATKDSF antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  82. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16588

    Description: epitope description:LTEPHITANKLEW antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  83. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16598

    Description: epitope description:VLNRDVSFQDLSD antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  84. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16599

    Description: epitope description:VLNRDVSFQDLSD antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  85. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16600

    Description: epitope description:FQDLSDNPCKVDL antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  86. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16601

    Description: epitope description:FQDLSDNPCKVDL antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  87. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16621

    Description: epitope description:HDTDCSSEGLLAS antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  88. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16622

    Description: epitope description:SEGLLASAPHLER antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  89. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16623

    Description: epitope description:SEGLLASAPHLER antigen name:Andes orthohantavirus protein host organism:Mus musculus

    Publication: 15780882;

  90. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10189

    Description: epitope description:IPVSDAQR antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  91. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10194

    Description: epitope description:AYVVAYQA antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  92. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10203

    Description: epitope description:QAGDQSYF antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  93. Identification of B-cell epitope of dengue virus type 1 and its application in diagnosis of patients.

    ID: 9370

    Description: epitope description:EHKYSWKS host organism:Mus musculus antibody name:15F3-1

    Publication: 11230414;

  94. Serodiagnosis of amoebiasis using a recombinant protein fragment of the 29 kDa surface antigen of Entamoeba histolytica.

    ID: 9391

    Description: epitope description:CQEKECCKECCCPRIKAFKKFINTFEKAQIGKEAPEFKAPA antigen name:Peroxiredoxin host organism:Homo sapiens

    Publication: 11428340;

  95. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 9900

    Description: epitope description:FTTKVIGKDSRDFDISPKV antigen name:F1 capsule antigen host organism:Oryctolagus cuniculus

    Publication: 10640611;

  96. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 9905

    Description: epitope description:VNGENLVGDDVVLAT antigen name:F1 capsule antigen host organism:Oryctolagus cuniculus

    Publication: 10640611;

  97. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 9910

    Description: epitope description:FFVRSIGSKGGKLAAGKYTDAVTV antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  98. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 9914

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  99. Monoclonal antibody to Shiga toxin 2 which blocks receptor binding and neutralizes cytotoxicity.

    ID: 9993

    Description: epitope description:E76 antigen name:Escherichia virus 933W protein host organism:Mus musculus BALB/c antibody name:Mab VTm1.1

    Publication: 10531220;

  100. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10182

    Description: epitope description:LRLRVTHQ antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston