Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378839

    Description: epitope description:RFRGKDLPVLDQLTD antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  2. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378855

    Description: epitope description:TIAWFRMGGNCAIPI antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  3. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378888

    Description: epitope description:PELAPEDPEDSALLE antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  4. Variability of the glycoprotein G gene in clinical isolates of herpes simplex virus type 1.

    ID: 1378995

    Description: epitope description:F111 antigen name:Envelope glycoprotein G host organism:Mus musculus antibody name:gG-1 mAb

    Publication: 10548571;

  5. Antibodies to an Epstein-Barr virus nuclear antigen synthetic peptide in infectious mononucleosis. Report of two cases.

    ID: 1379003

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 2552793;

  6. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379010

    Description: epitope description:GRLKAESTV antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:Mab C5

    Publication: 10022802;

  7. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379012

    Description: epitope description:VFPTKDVAL antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C6

    Publication: 10022802;

  8. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379013

    Description: epitope description:DPVAALFFF antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C11

    Publication: 10022802;

  9. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379014

    Description: epitope description:AALFFFDID antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C11

    Publication: 10022802;

  10. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379021

    Description: epitope description:MTRGRLKAE antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C13 and C5

    Publication: 10022802;

  11. Development of recombinant diagnostic reagents based on pp85(U14) and p86(U11) proteins to detect the human immune response to human herpesvirus 7 inf...

    ID: 1379034

    Description: epitope description:SRPGSTTPSGNSARYGNNT antigen name:U14 protein host organism:Mus musculus BALB/c antibody name:MAb 5E1

    Publication: 10565918;

  12. Mapping of the epitopes of Epstein-Barr virus gp350 using monoclonal antibodies and recombinant proteins expressed in Escherichia coli defines three a...

    ID: 1379106

    Description: epitope description:PASQDMPTNTTDITYV antigen name:Envelope glycoprotein GP350 host organism:Mus musculus antibody name:BMA-17

    Publication: 1719128;

  13. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379120

    Description: epitope description:MTDSPGGVAP antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c antibody name:13

    Publication: 8578868;

  14. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379122

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  15. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379124

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  16. HSP 90, yeasts and Corynebacterium jeikeium.

    ID: 1379146

    Description: epitope description:STDEPAGESA antigen name:Heat shock protein 90 homolog host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1718769;

  17. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379176

    Description: epitope description:MSRTKETARAKRTITSKKSK antigen name:Putative histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  18. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379177

    Description: epitope description:KRTITSKKSKKAPSGASGVK antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  19. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379179

    Description: epitope description:RSHRRWRPGTCAIREIRKFQ antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  20. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379186

    Description: epitope description:TNLACIHAKRVTIQPKDIQL antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston