Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486233

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  2. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486235

    Description: epitope description:R764, T827 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  3. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486252

    Description: epitope description:R764 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB115c

    Publication: 1381537;

  4. Production and characteristics of strain common antibodies against a synthetic polypeptide corresponding to the C-terminal region of potato virus Y co...

    ID: 1486254

    Description: epitope description:HTTEDVSPSMHTLLGVKNM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1474133;

  5. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486423

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  6. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486426

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  7. Virus-specific CTL responses induced by an H-2K(d)-restricted, motif-negative 15-mer peptide from the fusion protein of respiratory syncytial virus.

    ID: 1486434

    Description: epitope description:ELQLLMQSTPPTNNR antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11807236;

  8. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486468

    Description: epitope description:S23 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.30, 1.44

    Publication: 7522372;

  9. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486492

    Description: epitope description:YGPGVDY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.29

    Publication: 7522372;

  10. Identification of a T-cell epitope adjacent to neutralization antigenic site 1 of poliovirus type 1.

    ID: 1486527

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1702841;

  11. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486538

    Description: epitope description:KNTTTTQTQPSK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  12. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486542

    Description: epitope description:TTQTQPSKPTTK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  13. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486560

    Description: epitope description:PPNKPNNDFHFE antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  14. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486566

    Description: epitope description:NDFHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  15. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486567

    Description: epitope description:DFHFEVFNFVPC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  16. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486568

    Description: epitope description:FHFEVFNFVPCS antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  17. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486573

    Description: epitope description:FEVFNFVPCSIC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  18. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486583

    Description: epitope description:NKKPGKKTTTKP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  19. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486586

    Description: epitope description:PGKKTTTKPTKK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  20. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486591

    Description: epitope description:TTKPTKKPTFKT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  21. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486592

    Description: epitope description:TKPTKKPTFKTT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  22. Epitope mapping of monoclonal antibodies to Escherichia coli ribosomal protein S3.

    ID: 1486593

    Description: epitope description:AAVEQPEKPAAQPKKQQRKGRK antigen name:30S ribosomal protein S3 host organism:Mus musculus BALB/c antibody name:392F10G8, 382D8G1B4, ...

    Publication: 1696825;

  23. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486610

    Description: epitope description:DHKPQTTKPKEV antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  24. Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

    ID: 1486611

    Description: epitope description:HKPQTTKPKEVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10781861;

  25. Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

    ID: 1486631

    Description: epitope description:YTASARGDLAHLTTT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

    Publication: 11348711;

  26. Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

    ID: 1486639

    Description: epitope description:YTTSTRGDLAHVTAT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

    Publication: 11348711;

  27. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486648

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9228999;

  28. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486649

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9228999;

  29. Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

    ID: 1486653

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 9228999;

  30. Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies...

    ID: 1486676

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Mus musculus antibody name:P1.1, P1.6,...

    Publication: 1522798;

  31. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486732

    Description: epitope description:AHETSLNAAGNSVIHYTNIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D2

    Publication: 12029154;

  32. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486781

    Description: epitope description:NRQDFTQDPG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4F9, 4H1, 5G3

    Publication: 12029154;

  33. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486785

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  34. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486787

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  35. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486805

    Description: epitope description:KEGYAMDHEGCKFSC antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  36. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486814

    Description: epitope description:IRPSGYCGRECGIKK antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  37. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486816

    Description: epitope description:LPNWVKVWDRATNKC antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  38. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486820

    Description: epitope description:WNYDNAYCDKLCKDK antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  39. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483618

    Description: epitope description:PSDTMQTRHVKNYHSRSES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  40. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483838

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 9495252;

  41. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483841

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  42. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483842

    Description: epitope description:LNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  43. Intrathecal humoral immune response in HAM/TSP in relation to HLA haplotype analysis.

    ID: 1483873

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:Intrathecal

    Publication: 8937542;

  44. Minor displacements in the insertion site provoke major differences in the induction of antibody responses by chimeric parvovirus-like particles.

    ID: 1483886

    Description: epitope description:NPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10544085;

  45. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483899

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus

    Publication: 11027638;

  46. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483901

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11027638;

  47. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483916

    Description: epitope description:(2E,4S)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:S412

    Publication: 16603628;

  48. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483927

    Description: epitope description:(2E,4R)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:R310

    Publication: 16603628;

  49. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483975

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;

  50. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483981

    Description: epitope description:TTCTASARGDLAHLTTTHACHL + CYSTL(C3, C20) host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston