Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Intranasal immunization of mice against influenza with synthetic peptides anchored to proteosomes.

    ID: 1007628

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 8585293;

  2. Anti-peptide antibodies detect steps in a protein conformational change: low-pH activation of the influenza virus hemagglutinin.

    ID: 1008058

    Description: epitope description:LCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKI antigen name:Hemagglutinin host organism:Oryctolagus cuniculus antibody name:3

    Publication: 2447101;

  3. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008559

    Description: epitope description:DYASLRSLVASSGTLEFINEGFNWTGVTQNGGSSAC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  4. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008588

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQTR antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  5. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008590

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQTR antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  6. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008593

    Description: epitope description:QDLPGNDNNSTATLC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  7. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008594

    Description: epitope description:QDLPGNDNNSTATLC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  8. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008603

    Description: epitope description:CLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKIC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  9. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008605

    Description: epitope description:NATELVQSSSTGKICNNPHRILDGINC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  10. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008606

    Description: epitope description:NATELVQSSSTGKICNNPHRILDGINC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston