Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484165

    Description: epitope description:TPLLYPSLALPAPHLTLPFNWTHCFDPQIQ antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus Lewis antibody name:REY11, ...

    Publication: 1698731;

  2. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484174

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  3. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484179

    Description: epitope description:PCHNSLILPPFSLSPVPTLGSRSRR antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH antibody name:REY30

    Publication: 1698731;

  4. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484186

    Description: epitope description:KSNHNNVYWLTIPPMKNLALGVINTL antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  5. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484188

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston