Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473907

    Description: epitope description:GQAKKKKPEKPHFPLAAEDDIRHHLTQT antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  2. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473908

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  3. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473912

    Description: epitope description:LGKIIAQQNQSRGKGPGKKIKNKNPEKP antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  4. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473916

    Description: epitope description:EFSLPTHHTVRLIRVTASPSA antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6

    Publication: 16426684;

  5. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473961

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  6. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473964

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  7. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473969

    Description: epitope description:CPFDTSPVVKGKYNTTLLNGSAF antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;

  8. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473971

    Description: epitope description:PIGWTGVIECTAVS antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;

  9. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473984

    Description: epitope description:FVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKID antigen name:Other Dermatophagoides farinae (American house dust mite) protein h...

    Publication: 7510559;

  10. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473989

    Description: epitope description:DVELSLRSSDIA antigen name:Other Dermatophagoides farinae (American house dust mite) protein host organism:Homo sapiens antibody na...

    Publication: 7510559;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston