Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10187

    Description: epitope description:QSTIPVSD antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  2. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10227

    Description: epitope description:FTGTTRSS antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  3. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10229

    Description: epitope description:GSYPDLER antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  4. A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

    ID: 10230

    Description: epitope description:SYPDLERY antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab

    Publication: 12733969;

  5. Synthetic recombinant vaccine expressing influenza haemagglutinin epitope in Salmonella flagellin leads to partial protection in mice.

    ID: 1004091

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1376012;

  6. Synthetic recombinant vaccine expressing influenza haemagglutinin epitope in Salmonella flagellin leads to partial protection in mice.

    ID: 1004097

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Mus musculus CD1

    Publication: 1376012;

  7. Genetic control and fine specificity of the immune response to a synthetic peptide of influenza virus hemagglutinin.

    ID: 1004098

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQT antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 3258640;

  8. Synthetic recombinant vaccine expressing influenza haemagglutinin epitope in Salmonella flagellin leads to partial protection in mice.

    ID: 1004103

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Mus musculus CD1

    Publication: 1376012;

  9. Antigenic determinants of influenza virus hemagglutinin. XII. the epitopes of a synthetic peptide representing the C-terminus of HA1.

    ID: 1004121

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQT antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2431541;

  10. Localization, synthesis, and activity of an antigenic site on influenza virus hemagglutinin.

    ID: 1004136

    Description: epitope description:GFFGAIAGFIE antigen name:Hemagglutinin host organism:Mus musculus antibody name:BHK 174/3, BHK 82/1, VIC 21/3, Texas 185/1, Texas ...

    Publication: 6187004;

  11. Antigenic determinants of influenza virus hemagglutinin. XII. the epitopes of a synthetic peptide representing the C-terminus of HA1.

    ID: 1004138

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQT antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2431541;

  12. Localization, synthesis, and activity of an antigenic site on influenza virus hemagglutinin.

    ID: 1004147

    Description: epitope description:GFFGAIAGFIE antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6187004;

  13. The structure of an antigenic determinant in a protein.

    ID: 1004256

    Description: epitope description:KWDLFVERSK antigen name:Hemagglutinin host organism:Mus musculus 129 GIX+ antibody name:23B05

    Publication: 6204768;

  14. Immunodominance with progenitor B cell diversity in the neutralizing antibody repertoire to influenza infection.

    ID: 1004334

    Description: epitope description:P159 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 7621857;

  15. Immunodominance with progenitor B cell diversity in the neutralizing antibody repertoire to influenza infection.

    ID: 1004335

    Description: epitope description:S161 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 7621857;

  16. Antigenic determinants of influenza virus hemagglutinin. XII. the epitopes of a synthetic peptide representing the C-terminus of HA1.

    ID: 1004523

    Description: epitope description:CPKYVKSEKLVLATGLRNVPEKQT host organism:Mus musculus BALB/c

    Publication: 2431541;

  17. Antigenic determinants of influenza virus hemagglutinin. XII. the epitopes of a synthetic peptide representing the C-terminus of HA1.

    ID: 1004526

    Description: epitope description:CPKYVKQNTLKLATGLRNVPQIES host organism:Mus musculus BALB/c

    Publication: 2431541;

  18. Antibodies elicited by influenza virus hemagglutinin fail to bind to synthetic peptides representing putative antigenic sites.

    ID: 1004543

    Description: epitope description:GVHHPSTNQEQTSLYVQASGRVTV + NAc(G1) antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2579329;

  19. Antibodies elicited by influenza virus hemagglutinin fail to bind to synthetic peptides representing putative antigenic sites.

    ID: 1004544

    Description: epitope description:GLFGAIAGFIENG + NAc(G1) antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2579329;

  20. Antibodies elicited by influenza virus hemagglutinin fail to bind to synthetic peptides representing putative antigenic sites.

    ID: 1004546

    Description: epitope description:APIDTCISE + NAc(A1) antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2579329;

  21. Analysis of epitopic residues introduced into the hybrid peptide vaccines prepared according to the cassette theory.

    ID: 1004571

    Description: epitope description:YEGFWTGVTQNAKGIT host organism:Mus musculus C57BL/6

    Publication: 7526571;

  22. Analysis of antibody-antigen and antibody-anti-(idiotypic antibody) cross-reactivity using synthetic peptide probes.

    ID: 1004592

    Description: epitope description:NVPEKQT antigen name:Hemagglutinin host organism:Mus musculus antibody name:1/1

    Publication: 7511212;

  23. Analysis of epitopic residues introduced into the hybrid peptide vaccines prepared according to the cassette theory.

    ID: 1004609

    Description: epitope description:YEGFSTGVTQKAKGIT host organism:Mus musculus C57BL/6

    Publication: 7526571;

  24. Analysis of epitopic residues introduced into the hybrid peptide vaccines prepared according to the cassette theory.

    ID: 1004610

    Description: epitope description:YEGFSTGVTQKAKGIT host organism:Mus musculus C57BL/6

    Publication: 7526571;

  25. Mechanism of antigenic variation in an individual epitope on influenza virus N9 neuraminidase.

    ID: 1004720

    Description: epitope description:S368, S373, N400 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:NC41

    Publication: 1700825;

  26. Mechanism of antigenic variation in an individual epitope on influenza virus N9 neuraminidase.

    ID: 1004725

    Description: epitope description:I369 antigen name:Neuraminidase host organism:Mus musculus BALB/c antibody name:NC24

    Publication: 1700825;

  27. Location of neutralizing epitopes on the hemagglutinin-esterase protein of influenza C virus.

    ID: 1004744

    Description: epitope description:D367 antigen name:Hemagglutinin-esterase-fusion glycoprotein host organism:Mus musculus antibody name:K16

    Publication: 1376542;

  28. Location of neutralizing epitopes on the hemagglutinin-esterase protein of influenza C virus.

    ID: 1004746

    Description: epitope description:L178, E208, K212 antigen name:Hemagglutinin-esterase-fusion glycoprotein host organism:Mus musculus antibody name:U2

    Publication: 1376542;

  29. Location of neutralizing epitopes on the hemagglutinin-esterase protein of influenza C virus.

    ID: 1004747

    Description: epitope description:T226, V266 antigen name:Hemagglutinin-esterase-fusion glycoprotein host organism:Mus musculus antibody name:D37

    Publication: 1376542;

  30. A hemagglutinin-based multipeptide construct elicits enhanced protective immune response in mice against influenza A virus infection.

    ID: 1004816

    Description: epitope description:VTGLRNIPSIQSR antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:Pooled sera

    Publication: 9557954;

  31. The antigenic structure of the influenza virus A/PR/8/34 hemagglutinin (H1 subtype).

    ID: 1004829

    Description: epitope description:V182, G186, I195, S220, G253, S287 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6186384;

  32. The antigenic structure of the influenza virus A/PR/8/34 hemagglutinin (H1 subtype).

    ID: 1004836

    Description: epitope description:L87, L88, V90, R91, S92, E132 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6186384;

  33. Three-dimensional structure of an antigenic mutant of the influenza virus haemagglutinin.

    ID: 1005200

    Description: epitope description:G146 antigen name:Hemagglutinin host organism:Mus musculus antibody name:HC3a

    Publication: 6207440;

  34. Antigenic analyses of influenza virus haemagglutinins with different receptor-binding specificities.

    ID: 1005226

    Description: epitope description:L226 antigen name:Hemagglutinin host organism:Mus musculus antibody name:HC68, HC67, Mem 3, HC3M, Mem 25.

    Publication: 6208680;

  35. An antigenic map of the haemagglutinin of the influenza Hong Kong subtype (H3N2), constructed using mouse monoclonal antibodies.

    ID: 1005380

    Description: epitope description:D188, A198 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6205255;

  36. Prevention of infection of influenza virus in DQ6 mice, a human model, by a peptide vaccine prepared according to the cassette theory.

    ID: 1006839

    Description: epitope description:WTGVTQN antigen name:Hemagglutinin host organism:Mus musculus HLA-DQ6 Tg

    Publication: 10195628;

  37. The antigenic structure of the influenza B virus hemagglutinin: operational and topological mapping with monoclonal antibodies.

    ID: 1006982

    Description: epitope description:K180, Q213, K216, P254 antigen name:Hemagglutinin host organism:Mus musculus antibody name:74/1

    Publication: 2414911;

  38. The antigenic structure of the influenza B virus hemagglutinin: operational and topological mapping with monoclonal antibodies.

    ID: 1007012

    Description: epitope description:N210, P254 antigen name:Hemagglutinin host organism:Mus musculus antibody name:114/4

    Publication: 2414911;

  39. The antigenic structure of the influenza B virus hemagglutinin: operational and topological mapping with monoclonal antibodies.

    ID: 1007023

    Description: epitope description:E211, Q213 antigen name:Hemagglutinin host organism:Capra hircus

    Publication: 2414911;

  40. Intranasal immunization of mice against influenza with synthetic peptides anchored to proteosomes.

    ID: 1007627

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 8585293;

  41. Intranasal immunization of mice against influenza with synthetic peptides anchored to proteosomes.

    ID: 1007628

    Description: epitope description:SKAFSNCYPYDVPDYASL antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 8585293;

  42. Anti-peptide antibodies detect steps in a protein conformational change: low-pH activation of the influenza virus hemagglutinin.

    ID: 1008058

    Description: epitope description:LCLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKI antigen name:Hemagglutinin host organism:Oryctolagus cuniculus antibody name:3

    Publication: 2447101;

  43. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008559

    Description: epitope description:DYASLRSLVASSGTLEFINEGFNWTGVTQNGGSSAC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  44. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008588

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQTR antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  45. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008590

    Description: epitope description:CPKYVKQNTLKLATGMRNVPEKQTR antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  46. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008593

    Description: epitope description:QDLPGNDNNSTATLC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  47. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008594

    Description: epitope description:QDLPGNDNNSTATLC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  48. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008603

    Description: epitope description:CLGHHAVPNGTLVKTITNDQIEVTNATELVQSSSTGKIC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  49. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008605

    Description: epitope description:NATELVQSSSTGKICNNPHRILDGINC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  50. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008606

    Description: epitope description:NATELVQSSSTGKICNNPHRILDGINC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  51. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008612

    Description: epitope description:CNNPHRIL antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  52. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008616

    Description: epitope description:CNNPHRILDGINC antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  53. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008623

    Description: epitope description:HCDGFQNE antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  54. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008626

    Description: epitope description:HCDGFQNEKWDLFVE antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  55. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008634

    Description: epitope description:GKVTVSTKRSQQTIIPNVGSRPWVRGL antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  56. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008643

    Description: epitope description:TQNGGSSACKRGPDS antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  57. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008647

    Description: epitope description:CKRGPDSG antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  58. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008650

    Description: epitope description:CKRGPDSGFFSRLNWLY antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  59. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008654

    Description: epitope description:CKRGPDSGFFSRLNWLYKSGSTYPVQNVTMPNNDNS antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  60. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008656

    Description: epitope description:CKRGPDSGFFSRLNWLYKSGSTYPVQNVTMPNNDNS antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  61. Immunogenic structure of the influenza virus hemagglutinin.

    ID: 1008663

    Description: epitope description:HHPSTDKEQTNLY antigen name:Hemagglutinin host organism:Oryctolagus cuniculus

    Publication: 6176330;

  62. An antigenic map of the haemagglutinin of the influenza Hong Kong subtype (H3N2), constructed using mouse monoclonal antibodies.

    ID: 1008715

    Description: epitope description:G129, Y155, S157, G158, S159, A160, Q189 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6205255;

  63. An antigenic map of the haemagglutinin of the influenza Hong Kong subtype (H3N2), constructed using mouse monoclonal antibodies.

    ID: 1008716

    Description: epitope description:S145, G146 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6205255;

  64. An antigenic map of the haemagglutinin of the influenza Hong Kong subtype (H3N2), constructed using mouse monoclonal antibodies.

    ID: 1008735

    Description: epitope description:Y172, S174 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 6205255;

  65. Production of murine monoclonal antibodies against sulcofuron and flucofuron by in vitro immunisation.

    ID: 1022900

    Description: epitope description:3,4-dichloroaniline host organism:Mus musculus BALB/c antibody name:S2B5/1/C3

    Publication: 8841454;

  66. Antibodies against OspA epitopes of Borrelia burgdorferi cross-react with neural tissue.

    ID: 1031534

    Description: epitope description:VFTKENTI antigen name:Outer surface protein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15652419;

  67. Localization and characterization of a specific linear epitope of the Brucella DnaK protein.

    ID: 1031797

    Description: epitope description:SSKDDVVDADYEEIDDNKKSS antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:V78/07B01/G11, V78/09D04...

    Publication: 9297829;

  68. Localization and characterization of a specific linear epitope of the Brucella DnaK protein.

    ID: 1031798

    Description: epitope description:SSKDDVVDADYEEIDDNKKSS antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:V78/07B01/G11, V78/09D04...

    Publication: 9297829;

  69. Localization and characterization of a specific linear epitope of the Brucella DnaK protein.

    ID: 1031799

    Description: epitope description:SSKDDVVDADYEEIDDNKKSS antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:V78/07B01/G11, V78/09D04...

    Publication: 9297829;

  70. Localization and characterization of a specific linear epitope of the Brucella DnaK protein.

    ID: 1031800

    Description: epitope description:SSKDDVVDADYEEIDDNKKSS antigen name:Chaperone protein DnaK host organism:Mus musculus BALB/c antibody name:V78/07B01/G11, V78/09D04...

    Publication: 9297829;

  71. Nucleocapsid formation and/or subsequent conformational change of rabies virus nucleoprotein (N) is a prerequisite step for acquiring the phosphatase-...

    ID: 1031801

    Description: epitope description:S389 + PHOS(S389) antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:5-2-26

    Publication: 10544112;

  72. Miller Fisher syndrome and Haemophilus influenzae infection.

    ID: 1031804

    Description: epitope description:alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->3)-beta-D-GalpNAc-(1->4)-[alpha-Neup5Ac-(2->3)]-beta-D-Galp-(1->4)-beta-...

    Publication: 11524480;

  73. Immunization against rabies with plant-derived antigen.

    ID: 1031859

    Description: epitope description:PPDQLVNLHDFRSDEIEHLVVEE antigen name:Glycoprotein host organism:Mus musculus Swiss Webster

    Publication: 9482911;

  74. Identification of B- and T-cell epitopes within the MTP40 protein of Mycobacterium tuberculosis and their correlation with the disease course.

    ID: 1041071

    Description: epitope description:INFNCEVWSNVSETISGPRLY antigen name:Other Mycobacterium tuberculosis protein host organism:Homo sapiens

    Publication: 1711013;

  75. Mucosal T cells induce systemic anergy for oral tolerance.

    ID: 1046784

    Description: epitope description:SYTESMAGKREMVIITIKSG antigen name:Other Escherichia coli protein host organism:Mus musculus BALB/c

    Publication: 7818546;

  76. Localization of a protective epitope on a Venezuelan equine encephalomyelitis (VEE) virus peptide that protects mice from both epizootic and enzootic ...

    ID: 1050348

    Description: epitope description:STEELFKEYKLTRPYMARC antigen name:Structural polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7543231;

  77. Localization of a protective epitope on a Venezuelan equine encephalomyelitis (VEE) virus peptide that protects mice from both epizootic and enzootic ...

    ID: 1066598

    Description: epitope description:YKLTRPYMARC antigen name:Structural polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7543231;

  78. A synthetic peptide to the E glycoprotein of Murray Valley encephalitis virus defines multiple virus-reactive T- and B-cell epitopes.

    ID: 1066624

    Description: epitope description:EILVEFEEPHATKQS antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 1383567;

  79. A synthetic peptide to the E glycoprotein of Murray Valley encephalitis virus defines multiple virus-reactive T- and B-cell epitopes.

    ID: 1066631

    Description: epitope description:STEWRNREILVE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1383567;

  80. A synthetic peptide to the E glycoprotein of Murray Valley encephalitis virus defines multiple virus-reactive T- and B-cell epitopes.

    ID: 1066632

    Description: epitope description:STEWRNREILVE antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 1383567;

  81. A synthetic peptide to the E glycoprotein of Murray Valley encephalitis virus defines multiple virus-reactive T- and B-cell epitopes.

    ID: 1066635

    Description: epitope description:STEWRNREILVE antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 1383567;

  82. Influence of intranasal immunization with synthetic peptides corresponding to conserved epitopes of M protein on mucosal colonization by group A strep...

    ID: 1067849

    Description: epitope description:SKQDIGALKQELAKKDEGNK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus

    Publication: 2458320;

  83. Synthetic peptides derived from the Listeria monocytogenes p60 protein as antigens for the generation of polyclonal antibodies specific for secreted c...

    ID: 1067861

    Description: epitope description:TDKAVSTPVA + ACET(T1) antigen name:Probable endopeptidase p60 host organism:Oryctolagus cuniculus

    Publication: 7944357;

  84. Synthetic peptides derived from the Listeria monocytogenes p60 protein as antigens for the generation of polyclonal antibodies specific for secreted c...

    ID: 1067871

    Description: epitope description:PTQEVKKETT + ACET(P1) antigen name:Probable endopeptidase p60 host organism:Oryctolagus cuniculus

    Publication: 7944357;

  85. Synthetic peptides derived from the Listeria monocytogenes p60 protein as antigens for the generation of polyclonal antibodies specific for secreted c...

    ID: 1067945

    Description: epitope description:APTEAAKPAP + ACET(A1) antigen name:Probable endopeptidase p60 host organism:Oryctolagus cuniculus

    Publication: 7944357;

  86. Synthetic peptides derived from the Listeria monocytogenes p60 protein as antigens for the generation of polyclonal antibodies specific for secreted c...

    ID: 1067948

    Description: epitope description:EQQTTTKAPT + ACET(E1) antigen name:Protein P60 host organism:Oryctolagus cuniculus

    Publication: 7944357;

  87. Identification and characterization of B-cell epitopes of IpaC, an invasion-associated protein of Shigella flexneri.

    ID: 1068494

    Description: epitope description:TLTPENTL antigen name:Invasin IpaC host organism:Mus musculus BALB/c antibody name:H8

    Publication: 1373401;

  88. Modulation of immune responses in Balb/c mice vaccinated with Brucella abortus Cu-Zn superoxide dismutase synthetic peptide vaccine.

    ID: 1068576

    Description: epitope description:GGDNYSDKPEPLGG antigen name:Superoxide dismutase [Cu-Zn] host organism:Mus musculus BALB/c

    Publication: 7526568;

  89. Modulation of immune responses in Balb/c mice vaccinated with Brucella abortus Cu-Zn superoxide dismutase synthetic peptide vaccine.

    ID: 1068585

    Description: epitope description:LAEIKQRSLMVHVGG antigen name:Superoxide dismutase [Cu-Zn] host organism:Mus musculus BALB/c

    Publication: 7526568;

  90. Localization of protective epitopes within the pilin subunit of the Vibrio cholerae toxin-coregulated pilus.

    ID: 1068591

    Description: epitope description:LDLTNITHVEKLCKGTAPFGVAFGNS antigen name:UniProt:A5F392 host organism:Mus musculus antibody name:16.1

    Publication: 1702758;

  91. Mimicry of the immunodominant conformation-dependent antigenic site of hepatitis A virus by motifs selected from synthetic peptide libraries.

    ID: 1068770

    Description: epitope description:MWLDVMYLKGGG host organism:Homo sapiens

    Publication: 7543581;

  92. Mimicry of the immunodominant conformation-dependent antigenic site of hepatitis A virus by motifs selected from synthetic peptide libraries.

    ID: 1068772

    Description: epitope description:MWLDVMYLKGGG host organism:Mus musculus BALB/c

    Publication: 7543581;

  93. Modulation of immune responses in Balb/c mice vaccinated with Brucella abortus Cu-Zn superoxide dismutase synthetic peptide vaccine.

    ID: 1068799

    Description: epitope description:LAEIKQRSLMVHVGG antigen name:Superoxide dismutase [Cu-Zn] host organism:Mus musculus BALB/c

    Publication: 7526568;

  94. Influence of intranasal immunization with synthetic peptides corresponding to conserved epitopes of M protein on mucosal colonization by group A strep...

    ID: 1068812

    Description: epitope description:LDASREAKKQVEKDLANLTAEL antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus

    Publication: 2458320;

  95. Localization of a protective epitope on a Venezuelan equine encephalomyelitis (VEE) virus peptide that protects mice from both epizootic and enzootic ...

    ID: 1068851

    Description: epitope description:EELFKEYK antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:1A2B-10

    Publication: 7543231;

  96. Location of a neutralization determinant in the E protein of yellow fever virus (17D vaccine strain).

    ID: 1068881

    Description: epitope description:N71 antigen name:Genome polyprotein host organism:Mus musculus antibody name:2E10

    Publication: 2446422;

  97. Antigenic structure of the flavivirus envelope protein E at the molecular level, using tick-borne encephalitis virus as a model.

    ID: 1068883

    Description: epitope description:A71 antigen name:Genome polyprotein host organism:Mus musculus antibody name:A3

    Publication: 2463377;

  98. Cross-reactive epitope mimics in a fragmented-genome phage display library derived from the rickettsia, Cowdria ruminantium.

    ID: 1069074

    Description: epitope description:SKQCDEIREKIKKCNLRQGKKKSALSKFTDHF antigen name:Other Ehrlichia ruminantium (heartwater rickettsia) protein host organism:Capra hirc...

    Publication: 10231087;

  99. A serotype-specific epitope of dengue virus 1 identified by phage displayed random peptide library.

    ID: 1069317

    Description: epitope description:HKYSWK antigen name:Genome polyprotein host organism:Mus musculus antibody name:15F3-1

    Publication: 7537702;

  100. A serotype-specific epitope of dengue virus 1 identified by phage displayed random peptide library.

    ID: 1069436

    Description: epitope description:HKYSWK antigen name:Genome polyprotein host organism:Mus musculus antibody name:15F3-1

    Publication: 7537702;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston