Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Isolation and characterization of a naturally occurring parainfluenza 3 virus variant.

    ID: 1484000

    Description: epitope description:L174, V191, S283, I567 antigen name:hemagglutinin-neuraminidase host organism:Mus musculus antibody name:342-11A, 341-7H, 343-5G, ...

    Publication: 7665656;

  2. Induction by synthetic peptides of broadly reactive, type-specific neutralizing antibody to poliovirus type 3.

    ID: 1484008

    Description: epitope description:AIIEVDNEQPTTRAQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2414909;

  3. Induction by synthetic peptides of broadly reactive, type-specific neutralizing antibody to poliovirus type 3.

    ID: 1484011

    Description: epitope description:EQPTTRAQKLFAMWRI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2414909;

  4. Induction by synthetic peptides of broadly reactive, type-specific neutralizing antibody to poliovirus type 3.

    ID: 1484016

    Description: epitope description:EQPTTRAQ antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2414909;

  5. Reactivity of anti-peptide and anti-poliovirus type 3 monoclonal antibodies with synthetic peptides.

    ID: 1484021

    Description: epitope description:EVDNEQPTTRAQKLFA antigen name:Genome polyprotein host organism:Mus musculus antibody name:NIB735

    Publication: 2431104;

  6. Influence of amino acid substitutions on antigenicity of immunodominant regions of the HTLV type I envelope surface gylcoprotein: a study using monocl...

    ID: 1484071

    Description: epitope description:FLNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Mus musculus antibody name:4F5F6

    Publication: 10408728;

  7. The molecular basis of virus crossreactivity and neutralisation after immunisation with optimised chimeric peptides mimicking a putative helical epito...

    ID: 1484075

    Description: epitope description:KPNLSSKRSELSQLSMYRVF antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 9881686;

  8. Antigenicity of a viral peptide displayed on beta-galactosidase fusion proteins is influenced by the presence of the homologous partner protein.

    ID: 1484085

    Description: epitope description:ASARGDLAHLTTT antigen name:Genome polyprotein host organism:Mus musculus antibody name:7FC12, 7CA8, 7JD1

    Publication: 8931330;

  9. Monoclonal antibody recognition of members of the meningococcal P1.10 variable region family: implications for serological typing and vaccine design.

    ID: 1484087

    Description: epitope description:QNQRPTL antigen name:Other Neisseria meningitidis protein host organism:Mus musculus antibody name:MN20F4.17

    Publication: 8581171;

  10. The molecular basis of virus crossreactivity and neutralisation after immunisation with optimised chimeric peptides mimicking a putative helical epito...

    ID: 1484090

    Description: epitope description:KPNLSSKRSELSQLSMYRVF antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 9881686;

  11. Generation of antiserum to specific epitopes.

    ID: 1484091

    Description: epitope description:ISKQEYDAAVTAK antigen name:Multidrug transporter host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9067972;

  12. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484097

    Description: epitope description:ANCASILCKCYTTGT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens

    Publication: 9311797;

  13. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484098

    Description: epitope description:DHCPVVEVNGVTIQV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens

    Publication: 9311797;

  14. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484106

    Description: epitope description:ANCASILCKCYTTGT antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9311797;

  15. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484109

    Description: epitope description:ANCASILCKCYTTGT antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9311797;

  16. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484110

    Description: epitope description:ANCASILCKCYTTGT antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA

    Publication: 9311797;

  17. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483620

    Description: epitope description:RFDLELTFVIT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  18. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483621

    Description: epitope description:QIMYVPPGGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  19. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483623

    Description: epitope description:INLRTNNSATIV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  20. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483624

    Description: epitope description:HVIWDVGLQSS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  21. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483643

    Description: epitope description:PALTAAETG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  22. Crossreactivity of mimotopes and peptide homologues of a sequential epitope with a monoclonal antibody does not predict crossreactive immunogenicity.

    ID: 1483681

    Description: epitope description:AVFVTSFLPQLSY host organism:Mus musculus antibody name:BH129

    Publication: 10506653;

  23. Serological prospects for peptide vaccines against foot-and-mouth disease virus.

    ID: 1483689

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Cavia porcellus Duncan-Hartley antibody name:anti-CC200-213-PPS-141-158PCG

    Publication: 2479714;

  24. Crossreactivity of mimotopes and peptide homologues of a sequential epitope with a monoclonal antibody does not predict crossreactive immunogenicity.

    ID: 1483707

    Description: epitope description:SELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10506653;

  25. Crossreactivity of mimotopes and peptide homologues of a sequential epitope with a monoclonal antibody does not predict crossreactive immunogenicity.

    ID: 1483709

    Description: epitope description:SELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10506653;

  26. Serological prospects for peptide vaccines against foot-and-mouth disease virus.

    ID: 1483715

    Description: epitope description:VPNLRGDSQVLAQKVARTLP host organism:Cavia porcellus Duncan-Hartley

    Publication: 2479714;

  27. Crossreactivity of mimotopes and peptide homologues of a sequential epitope with a monoclonal antibody does not predict crossreactive immunogenicity.

    ID: 1483719

    Description: epitope description:SEMPQLPSEMPQLP host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 10506653;

  28. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483739

    Description: epitope description:DLLALSADQALQPPCPNLVSYSS antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  29. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483740

    Description: epitope description:LALSADQALQPPCPNLVSYSSYH antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  30. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483743

    Description: epitope description:VSYSSYHATYSLYLFPHWTKKPNR antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  31. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483750

    Description: epitope description:SYSDPCSLKCPYLGCQSWTCPYT antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  32. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483774

    Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  33. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483778

    Description: epitope description:YPSLALPAPHLTLPFNWTHCFDP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  34. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483780

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  35. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483797

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c

    Publication: 9495252;

  36. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483799

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C6

    Publication: 9495252;

  37. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483811

    Description: epitope description:LLPHSNLDHILEPSIPWKSKLLT antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  38. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483815

    Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  39. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483822

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 9495252;

  40. Identification of an immunodominant neutralizing and protective epitope from measles virus fusion protein by using human sera from acute infection.

    ID: 1484154

    Description: epitope description:ANCASILCKCYTTGT antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA

    Publication: 9311797;

  41. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484165

    Description: epitope description:TPLLYPSLALPAPHLTLPFNWTHCFDPQIQ antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus Lewis antibody name:REY11, ...

    Publication: 1698731;

  42. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484174

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  43. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484179

    Description: epitope description:PCHNSLILPPFSLSPVPTLGSRSRR antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH antibody name:REY30

    Publication: 1698731;

  44. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484186

    Description: epitope description:KSNHNNVYWLTIPPMKNLALGVINTL antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  45. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484188

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  46. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484189

    Description: epitope description:PTTRTDDKLR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  47. Mapping of antigenic sites on the major inner capsid protein of avian rotavirus using an Escherichia coli expression system.

    ID: 1484195

    Description: epitope description:FQTGGIGNLPVRNWTFDFGTL antigen name:Intermediate capsid protein VP6 host organism:Mus musculus BALB/c antibody name:P3-29

    Publication: 8973528;

  48. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484198

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Mus musculus antibody name:2A12, 2E5,3E9, 5C4

    Publication: 16931331;

  49. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484206

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Cavia porcellus Duncan-Hartley

    Publication: 16931331;

  50. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484217

    Description: epitope description:GMYGGTYLVEKP antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston