Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1207332

    Description: epitope description:FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLD host organism:Mus musculus C57BL/6

    Publication: 9714413;

  2. Lassa virus glycoproteins: antigenic and immunogenic properties of synthetic peptides to GP1.

    ID: 1209200

    Description: epitope description:NLSDAHKKNLYDHAL antigen name:Pre-glycoprotein polyprotein GP complex host organism:Oryctolagus cuniculus

    Publication: 1701079;

  3. Lassa virus glycoproteins: antigenic and immunogenic properties of synthetic peptides to GP1.

    ID: 1209204

    Description: epitope description:VQYNLSHSYAGDA antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus CBA

    Publication: 1701079;

  4. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19265

    Description: epitope description:QAYAGVRKRYVAKPSD antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  5. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19277

    Description: epitope description:TTTQLVVAITALLITA antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  6. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19279

    Description: epitope description:ITALLITAFAICACLE antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  7. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19287

    Description: epitope description:FAICACLEPRLIGASG antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  8. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19291

    Description: epitope description:PRLIGASGPLIWGCLA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  9. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19295

    Description: epitope description:PLIWGCLALVALLPLL antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  10. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19297

    Description: epitope description:PLIWGCLALVALLPLL antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston