Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486997

    Description: epitope description:IVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  2. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486999

    Description: epitope description:FNWTHCFDPQI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  3. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487000

    Description: epitope description:SPCHNSLILP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  4. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487002

    Description: epitope description:NTEPSQLPPTA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  5. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487013

    Description: epitope description:DAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILE antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston