Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Inhibition of staphylococcal enterotoxin A-induced superantigenic and lethal activities by a monoclonal antibody to toxic shock syndrome toxin-1.

    ID: 20485

    Description: epitope description:YYSPAF antigen name:UniProt:D6SEW7 host organism:Mus musculus BALB/c antibody name:MAb5

    Publication: 11372026;

  2. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21013

    Description: epitope description:LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGD antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-1C6

    Publication: 11129631;

  3. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21014

    Description: epitope description:LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGD antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-1C6

    Publication: 11129631;

  4. Genomic analysis of matrix gene and antigenic studies of its gene product (M1) of a swine influenza virus (H1N1) causing chronic respiratory disease i...

    ID: 21016

    Description: epitope description:GLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQ antigen name:Matrix protein 1 host organism:Mus musculus antibody name:M1-289/4

    Publication: 11129631;

  5. MUC1 mucin-mediated regulation of human T cells.

    ID: 21036

    Description: epitope description:APDTRPAP antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:DF3 anti-MUC1 Ab

    Publication: 15710907;

  6. MUC1 mucin-mediated regulation of human T cells.

    ID: 21040

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:DH-1 ...

    Publication: 15710907;

  7. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21394

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  8. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21397

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  9. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21434

    Description: epitope description:TFNFDNEPENISIENLSSD antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  10. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 21438

    Description: epitope description:NLSSDIIGQLELMPNIERF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston