Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415589

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  2. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415590

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  3. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415591

    Description: epitope description:PLLDRWKAPDYVPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  4. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415594

    Description: epitope description:PLLDRWKAPDYVPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  5. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415599

    Description: epitope description:PAADRAAAPDAVAA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  6. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415607

    Description: epitope description:TVHGCALPPRGAPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  7. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415610

    Description: epitope description:TVHGCALPPRGAPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  8. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415611

    Description: epitope description:VPPPRRKRTIQLDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  9. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415615

    Description: epitope description:VPPPRRKRTIQLDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  10. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415620

    Description: epitope description:DGSNVLAALAALAE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  11. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415621

    Description: epitope description:ALAALAEKSFPSSS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  12. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415626

    Description: epitope description:KSFPSSSSSGVDTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  13. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415630

    Description: epitope description:KSFPSSSSSGVDTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  14. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415638

    Description: epitope description:SSTTSKVPPSPGGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  15. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415651

    Description: epitope description:STVSDSEEQSVVCC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  16. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415663

    Description: epitope description:QVLDDHYKTALKEV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  17. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415664

    Description: epitope description:QVLDDHYKTALKEV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  18. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415672

    Description: epitope description:RSKFGYSAKDVRSL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  19. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415683

    Description: epitope description:QQRVERLLKMWTSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  20. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415685

    Description: epitope description:QQRVERLLKMWTSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  21. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415686

    Description: epitope description:VEEEIYQCCNLEPE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  22. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415694

    Description: epitope description:CCNLEPEARKVISS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  23. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415698

    Description: epitope description:LYCGGPMFNSKGAQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  24. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415702

    Description: epitope description:SGVLPTSFGNTITC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  25. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415709

    Description: epitope description:TAAAKAAGLRNPDF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  26. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415713

    Description: epitope description:VAESDGVDEDRAAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  27. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415714

    Description: epitope description:VAESDGVDEDRAAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  28. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415716

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  29. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415717

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  30. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415719

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  31. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415726

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  32. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415727

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  33. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415728

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  34. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415731

    Description: epitope description:PLDFEMYGATYSVT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  35. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415737

    Description: epitope description:CPPLRAWRHRARAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  36. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415746

    Description: epitope description:PLPAAGQLDLSSWF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  37. Expression of HTLV-I Env and Tax recombinant peptides in yeast: identification of immunogenic domains.

    ID: 1463995

    Description: epitope description:TPLLYPSLALPAPHLTLPFNWTH antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 7679862;

  38. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464042

    Description: epitope description:CKEDYRYAISSTNEIGLLGAGGLT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  39. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464046

    Description: epitope description:TTDSGDGRQTIT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  40. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464066

    Description: epitope description:QTITNPAYDEKR antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  41. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464070

    Description: epitope description:TDSSSDSQTITN antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  42. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464084

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  43. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464086

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  44. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464096

    Description: epitope description:SLHKGALLTSVTFELLFDGTN antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  45. Mutational analysis of amino acid positions crucial for IgE-binding epitopes of the major apple (Malus domestica) allergen, Mal d 1.

    ID: 1464105

    Description: epitope description:T11, F31, S57, S113, I114 antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 16293967;

  46. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1464109

    Description: epitope description:SQWGWCGSTDEYCSPDHNCQ antigen name:Hev b 6 host organism:Mus musculus antibody name:1A5.4.3

    Publication: 15080815;

  47. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1464113

    Description: epitope description:SICGNNQLCKSICKT antigen name:Major surface glycoprotein G host organism:Mus musculus antibody name:8188, 8305, 9177, 26

    Publication: 1697913;

  48. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464115

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  49. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464118

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  50. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464125

    Description: epitope description:APPSQPFPWTHCYQPRL antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  51. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464129

    Description: epitope description:AQYAAQNRRGLDLLFW antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  52. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464174

    Description: epitope description:NCKITKTPTAWKPNYAPANCPKS antigen name:UniProt:W5V4N0 host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;

  53. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464207

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;

  54. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464210

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) ...

    Publication: 15386623;

  55. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464216

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) s...

    Publication: 15386623;

  56. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464221

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;

  57. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464234

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;

  58. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464244

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;

  59. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464245

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P se...

    Publication: 15386623;

  60. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464246

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;

  61. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464251

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  62. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464253

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;

  63. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464256

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  64. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464257

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  65. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464260

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;

  66. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464262

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  67. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464263

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  68. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464265

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;

  69. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464267

    Description: epitope description:SCATTVDAKFRPNGCTD antigen name:UniProt:W5V4N0 host organism:Oryctolagus cuniculus antibody name:P286 (PAK) sera

    Publication: 15386623;

  70. Expression of HTLV-I Env and Tax recombinant peptides in yeast: identification of immunogenic domains.

    ID: 1464523

    Description: epitope description:SVPSSSSTPLLYPSLALPAPHLTLPFNWT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 7679862;

  71. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464530

    Description: epitope description:HPDSIHPFLASP host organism:Mus musculus BALB/c antibody name:2B1

    Publication: 17445956;

  72. Vaccination against lethal coronavirus-induced encephalitis with a synthetic decapeptide homologous to a domain in the predicted peplomer stalk.

    ID: 1464552

    Description: epitope description:CVKSQTTRIN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 2455823;

  73. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464569

    Description: epitope description:RTNHSGNSVPDK host organism:Mus musculus BALB/c antibody name:F1

    Publication: 17445956;

  74. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464574

    Description: epitope description:QKLPYGPRFWLG host organism:Mus musculus BALB/c antibody name:F7

    Publication: 17445956;

  75. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464580

    Description: epitope description:HTADKYVSELMG host organism:Mus musculus BALB/c antibody name:B34

    Publication: 17445956;

  76. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464591

    Description: epitope description:VHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  77. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464593

    Description: epitope description:WHVLYTPNISIPQQTSSRTILFP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  78. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473902

    Description: epitope description:LGKIIAQQNQSRGKGPGKKSKKKSPEKP antigen name:Nucleoprotein host organism:Mus musculus antibody name:5H2

    Publication: 16426684;

  79. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473905

    Description: epitope description:VNQLCQLLGAMIKSQRQQPGGQAKKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  80. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473906

    Description: epitope description:KKNKKKNPEKPHFPLATEDDVRHHFTPS antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6

    Publication: 16426684;

  81. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473907

    Description: epitope description:GQAKKKKPEKPHFPLAAEDDIRHHLTQT antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  82. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473908

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  83. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473912

    Description: epitope description:LGKIIAQQNQSRGKGPGKKIKNKNPEKP antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  84. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473916

    Description: epitope description:EFSLPTHHTVRLIRVTASPSA antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6

    Publication: 16426684;

  85. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473961

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  86. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473964

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  87. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473969

    Description: epitope description:CPFDTSPVVKGKYNTTLLNGSAF antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;

  88. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473971

    Description: epitope description:PIGWTGVIECTAVS antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;

  89. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473984

    Description: epitope description:FVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKID antigen name:Other Dermatophagoides farinae (American house dust mite) protein h...

    Publication: 7510559;

  90. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473989

    Description: epitope description:DVELSLRSSDIA antigen name:Other Dermatophagoides farinae (American house dust mite) protein host organism:Homo sapiens antibody na...

    Publication: 7510559;

  91. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474000

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  92. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474003

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  93. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474004

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  94. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474013

    Description: epitope description:GKKNKKKNP antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  95. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474014

    Description: epitope description:GKKNKKKNP antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  96. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474017

    Description: epitope description:KNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  97. Identification of immunodominant VP1 linear epitope of enterovirus 71 (EV71) using synthetic peptides for detecting human anti-EV71 IgG antibodies in ...

    ID: 1474025

    Description: epitope description:LEGTTNPNG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18076666;

  98. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474037

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  99. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474044

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  100. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474045

    Description: epitope description:VNQLCQLLGAMIKSQRQQPGGQAKKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston