Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A recombinant subunit vaccine based on the insertion of 27 amino acids from Omp31 to the N-terminus of BLS induced a similar degree of protection agai...

    ID: 1462970

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c antibody name...

    Publication: 17442465;

  2. A recombinant subunit vaccine based on the insertion of 27 amino acids from Omp31 to the N-terminus of BLS induced a similar degree of protection agai...

    ID: 1462975

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c antibody name...

    Publication: 17442465;

  3. Modulation of T-cell reactivity to synthetic peptide analogues of foot-and-mouth disease virus in sheep by amino acid substitutions.

    ID: 1463005

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Ovis aries Finnish Landrace

    Publication: 1375405;

  4. Modulation of T-cell reactivity to synthetic peptide analogues of foot-and-mouth disease virus in sheep by amino acid substitutions.

    ID: 1463008

    Description: epitope description:CCRHKQKDVGPVKQTLPPS host organism:Ovis aries Finnish Landrace

    Publication: 1375405;

  5. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1463021

    Description: epitope description:SICSNNPTCWAICKR antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus

    Publication: 1697913;

  6. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1463044

    Description: epitope description:SICSNNPTCWAICKR antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 1697913;

  7. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1463049

    Description: epitope description:SICGNNQLCKSICKT antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 1697913;

  8. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463086

    Description: epitope description:VKQSRGEA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:mAbs 3E1, 6E4 and 11C9

    Publication: 16944047;

  9. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463088

    Description: epitope description:VKQSRGEA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:mAb 22G2

    Publication: 16944047;

  10. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463090

    Description: epitope description:QSRGEAR antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:mAbs 3E1, 6E4 and 11C9

    Publication: 16944047;

  11. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463092

    Description: epitope description:QSRGEAR antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 16944047;

  12. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463094

    Description: epitope description:QVSFLQGDQSENE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  13. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463097

    Description: epitope description:QSRGEARESYRETGPSRA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  14. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463116

    Description: epitope description:ARAAHLPTGTPLD antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  15. Mapping of B cell epitopes in measles virus nucleocapsid protein.

    ID: 1463117

    Description: epitope description:AAHLPTGTPLDID antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 16944047;

  16. Serum and mucosal antibodies of infected foals recognized two distinct epitopes of VapA of Rhodococcus equi.

    ID: 1463126

    Description: epitope description:VSFQYNAVGPYLNINFFDSS antigen name:Virulence associated protein VapA host organism:Equus caballus antibody name:Horse serum

    Publication: 12443830;

  17. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416696

    Description: epitope description:VVERLGDYLLEQGM antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  18. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415780

    Description: epitope description:IPKVPPGPNITATYGDKWLDAKSTWYGKPTG antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 3

    Publication: 11511525;

  19. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415781

    Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 4

    Publication: 11511525;

  20. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415782

    Description: epitope description:VRYTTEGGTKTEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 5

    Publication: 11511525;

  21. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415787

    Description: epitope description:HVEKGSNPNYLALLVKYVNGDGDVVAV antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 1

    Publication: 11511525;

  22. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415790

    Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 4

    Publication: 11511525;

  23. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415791

    Description: epitope description:VRYTTEGGTKTEAEDVIPEGWKADTSYESK antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 5

    Publication: 11511525;

  24. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415793

    Description: epitope description:HVEKGSNPNYLALLVKYVNGDGDVVAV antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 1

    Publication: 11511525;

  25. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415800

    Description: epitope description:IPKVPPGPNITATYGDKWLDAKSTWYGKPTG antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 3

    Publication: 11511525;

  26. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415802

    Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 4

    Publication: 11511525;

  27. Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

    ID: 1415812

    Description: epitope description:GYKDVDKPPFSGMTGCGNTPIFKSGRGC antigen name:Phl p 1 host organism:Oryctolagus cuniculus antibody name:anti-peptide 4

    Publication: 11511525;

  28. Characterization of monoclonal antibody to the Epstein-Barr virus BHRF1 protein, a homologue of Bcl-2.

    ID: 1415871

    Description: epitope description:VLELAA antigen name:Apoptosis regulator BHRF1 host organism:Mus musculus BALB/c antibody name:MAb 3E8

    Publication: 15000846;

  29. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415958

    Description: epitope description:DQVDVKDCANHEIKK antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  30. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415963

    Description: epitope description:EAVFEANQNTKTAK + ACET(E1) antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  31. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415964

    Description: epitope description:TKTAKIEIKASIDG + ACET(T1) antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  32. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415967

    Description: epitope description:HYMKCPLVKGQQYD + ACET(H1) antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  33. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415970

    Description: epitope description:SENVVVTVKVMGDD + ACET(S1) antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  34. Epitope mapping of the Dermatophagoides pteronyssinus house dust mite major allergen Der p II using overlapping synthetic peptides.

    ID: 1415972

    Description: epitope description:VLACAIATHAKIRD + ACET(V1) antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 1720504;

  35. An experimental and modeling-based approach to locate IgE epitopes of plant profilin allergens.

    ID: 1416085

    Description: epitope description:APTGLFLGGT antigen name:Other Cucumis melo (Oriental melon) protein host organism:Homo sapiens antibody name:patient sera

    Publication: 17397911;

  36. An experimental and modeling-based approach to locate IgE epitopes of plant profilin allergens.

    ID: 1416092

    Description: epitope description:KTNQALIIGI antigen name:Other Cucumis melo (Oriental melon) protein host organism:Homo sapiens antibody name:patient sera

    Publication: 17397911;

  37. An experimental and modeling-based approach to locate IgE epitopes of plant profilin allergens.

    ID: 1416094

    Description: epitope description:YDEPLTPGQC antigen name:Other Cucumis melo (Oriental melon) protein host organism:Homo sapiens antibody name:patient sera

    Publication: 17397911;

  38. An experimental and modeling-based approach to locate IgE epitopes of plant profilin allergens.

    ID: 1416098

    Description: epitope description:LGDYLIEQGL antigen name:Other Cucumis melo (Oriental melon) protein host organism:Homo sapiens antibody name:patient sera

    Publication: 17397911;

  39. N-terminus of a major allergen, Alt a I, of Alternaria alternata defined to be an epitope.

    ID: 1416262

    Description: epitope description:ADPVTTEGDYVVKISEFYGR antigen name:Alt a 1 host organism:Mus musculus BALB/c

    Publication: 7580290;

  40. Olive pollen allergy: searching for immunodominant T-cell epitopes on the Ole e 1 molecule.

    ID: 1416667

    Description: epitope description:QCKDKENGDVTF antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 9641567;

  41. A glycine-rich bovine herpesvirus 5 (BHV-5) gE-specific epitope within the ectodomain is important for BHV-5 neurovirulence.

    ID: 1416669

    Description: epitope description:GGEGEGGKGGRGAAK antigen name:envelope glycoprotein E host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit an...

    Publication: 15078962;

  42. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416674

    Description: epitope description:MSWQAYVDEHLMCD antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  43. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416680

    Description: epitope description:DEHLMCDIEGTGQH antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  44. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416682

    Description: epitope description:LTSAAILGLDGTVW antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  45. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416683

    Description: epitope description:GLDGTVWAQSAKFP antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  46. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416684

    Description: epitope description:AQSAKFPQFKPEEM antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  47. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416686

    Description: epitope description:KGIIKEFDEAGTLA antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  48. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416694

    Description: epitope description:GIYDEPVAPGQCNM antigen name:Hel a 2 host organism:Oryctolagus cuniculus antibody name:anti-profilin

    Publication: 12202397;

  49. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416705

    Description: epitope description:YDEPVAPG antigen name:Hel a 2 host organism:Mus musculus BALB/c antibody name:9G4

    Publication: 12202397;

  50. Molecular and structural analysis of the panallergen profilin B cell epitopes defined by monoclonal antibodies.

    ID: 1416719

    Description: epitope description:FPQFKPEE antigen name:Hel a 2 host organism:Mus musculus BALB/c antibody name:5F2

    Publication: 12202397;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston