Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484219

    Description: epitope description:LKIKIASGFGPLITHGSGMDLYK antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  2. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484220

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Cavia porcellus Duncan-Hartley

    Publication: 16931331;

  3. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484239

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 1379626;

  4. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484246

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA

    Publication: 1379626;

  5. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484247

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J

    Publication: 1379626;

  6. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484249

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 1379626;

  7. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484250

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1379626;

  8. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484255

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J

    Publication: 1379626;

  9. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484264

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 1379626;

  10. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484266

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 1379626;

  11. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484277

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1379626;

  12. Identification of T-cell epitopes adjacent to neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1484304

    Description: epitope description:SELLSLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 7685537;

  13. Identification of T-cell epitopes adjacent to neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1484306

    Description: epitope description:SELLSLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 7685537;

  14. Identification of T-cell epitopes adjacent to neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1484311

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 7685537;

  15. Identification of T-cell epitopes adjacent to neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1484321

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 7685537;

  16. A mutational approach shows similar mechanisms of recognition for the isolated and integrated versions of a protein epitope.

    ID: 1484324

    Description: epitope description:HGRVGIYFGMK antigen name:Tryptophan synthase beta chain host organism:Mus musculus antibody name:mAb 164

    Publication: 9856999;

  17. Induction of effective cross-reactive immunity by FMDV peptides is critically dependent upon specific MHC-peptide-T cell interactions.

    ID: 1484414

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Bos taurus Friesian

    Publication: 8045586;

  18. Human T-lymphotropic virus type 1 peptides in chimeric and multivalent constructs with promiscuous T-cell epitopes enhance immunogenicity and overcome...

    ID: 1484420

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c

    Publication: 7545241;

  19. Identification of amino acids critical for IgE-binding to sequential epitopes of bovine kappa-casein and the similarity of these epitopes to the corre...

    ID: 1486826

    Description: epitope description:AKYIPIQYVLSRYP antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 18186809;

  20. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486836

    Description: epitope description:GYAMDHEGCKFSCFI antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  21. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486844

    Description: epitope description:PAGFCDGYCKTHLKA antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  22. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486845

    Description: epitope description:GFCDGYCKTHLKASS antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  23. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486848

    Description: epitope description:THLKASSGYCAWPAC antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  24. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486849

    Description: epitope description:LKASSGYCAWPACYC antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  25. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486894

    Description: epitope description:CGIKKGSSGYCAWPA antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  26. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486897

    Description: epitope description:SSGYCAWPACYCYGL antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  27. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486910

    Description: epitope description:VEYDNCAYICWNYDN antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  28. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486927

    Description: epitope description:YCDKLCKDKKADSGY antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  29. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486942

    Description: epitope description:YCYWVHILCYCYGLP antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  30. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486994

    Description: epitope description:NTEPSQLPPTA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  31. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486997

    Description: epitope description:IVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  32. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486999

    Description: epitope description:FNWTHCFDPQI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  33. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487000

    Description: epitope description:SPCHNSLILP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  34. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487002

    Description: epitope description:NTEPSQLPPTA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  35. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487013

    Description: epitope description:DAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILE antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  36. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487025

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  37. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487026

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  38. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487027

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  39. Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide.

    ID: 1487033

    Description: epitope description:LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musc...

    Publication: 18258632;

  40. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487057

    Description: epitope description:C181, N182, A183, S184, K185, F186, H187, Q188, G189, C190, L191, L192, V193, V194, C195, V196, P197, E198, A199, E200, M201, G20...

    Publication: 12029154;

  41. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487058

    Description: epitope description:NQFLTSDDFQSPSAMPQFDVTPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H2, 1H7, 3D7, 5D6,...

    Publication: 12029154;

  42. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487065

    Description: epitope description:PADAQSDCKILCFVSACNDF antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H2, 1H7, 3D7, 5D6, 3C1, 4A9

    Publication: 12029154;

  43. Novel sequences and epitopes of diagnostic value derived from the Anisakis simplex Ani s 7 major allergen.

    ID: 1487303

    Description: epitope description:MCQCVQKYGTEFCKKRLA antigen name:Other Anisakis simplex (herring worm) protein host organism:Mus musculus antibody name:UA3

    Publication: 18186812;

  44. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487309

    Description: epitope description:DIQEEITRHE antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  45. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487317

    Description: epitope description:PTGIEPDDHL antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  46. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487338

    Description: epitope description:KNTLQARQQT antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  47. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487340

    Description: epitope description:ADAVSRKKMD antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  48. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487344

    Description: epitope description:TADWYTIGVY antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  49. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487345

    Description: epitope description:TIGVYVIGFT antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  50. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487347

    Description: epitope description:IPIILKALYM antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston