Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186397

    Description: epitope description:WDQAYRKPITYDTLWQADTD antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  2. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186405

    Description: epitope description:TQVLVPRSAIDSMLA antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  3. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187142

    Description: epitope description:AADKPTLDIRMMNIEATNLAL antigen name:Genome polyprotein host organism:Mus musculus C3H

    Publication: 1832722;

  4. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187152

    Description: epitope description:GSTDSTSHGNYSTQIGANQAVRFTI antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1832722;

  5. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187171

    Description: epitope description:CKIPISSVASLNDMTPVGR antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 1832722;

  6. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187176

    Description: epitope description:VTANPYVASSTANAKVLVEIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1832722;

  7. Identification of helper T cell epitopes of dengue virus E-protein.

    ID: 1187188

    Description: epitope description:KGMSYSMCTGKFK antigen name:Genome polyprotein host organism:Mus musculus DBA/1

    Publication: 7683752;

  8. Identification of helper T cell epitopes of dengue virus E-protein.

    ID: 1187198

    Description: epitope description:GQLKLNWFKKGSSIG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7683752;

  9. Immune response related to the molecular structure of a peptide from the cholera toxin B subunit.

    ID: 1193772

    Description: epitope description:VEVPGSQHIDSQKKAIERMKNTLRIA antigen name:Cholera enterotoxin subunit B host organism:Mus musculus C57BL/6

    Publication: 7504858;

  10. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1197630

    Description: epitope description:ILSVYHPQQFIYAGSLSALMDPSQGMGPSLI host organism:Mus musculus BALB/c

    Publication: 9714413;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston