Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209266

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  2. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209282

    Description: epitope description:SRSTSLSVSLVLVGVVTLYLGVMV antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  3. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209284

    Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7505071;

  4. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209285

    Description: epitope description:IYGAAFSGVSWTMKILIGVIITWIGMNS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7505071;

  5. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212427

    Description: epitope description:G53, I55, K166, K217, A219 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:719.3

    Publication: 2446011;

  6. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212430

    Description: epitope description:G53, I55, K166, K217 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:PVK

    Publication: 2446011;

  7. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212439

    Description: epitope description:G59, S61, R203, K217 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:PVE

    Publication: 2446011;

  8. Mapping of functional regions of Clostridium perfringens type A enterotoxin.

    ID: 1212441

    Description: epitope description:SLDAGQYVLVMKANSSYSGNYPYSILFQKF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1373406;

  9. Mapping of functional regions of Clostridium perfringens type A enterotoxin.

    ID: 1212452

    Description: epitope description:SLDAGQYVLVMKANSSYSGNYPYSILFQKF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1373406;

  10. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1212485

    Description: epitope description:MRCIGISNRDFVEGVSGGSWVDIVLEHGSC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston