Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Liposomes as vehicles for the presentation of a synthetic peptide containing an epitope of hepatitis A virus.

    ID: 21742

    Description: epitope description:ASICQMFCFWRGDLVFDFQV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:anti-(105,109Abu)VP3(102-12...

    Publication: 10506652;

  2. Epitope specificity and isoforms of the mycobacterial 19-kilodalton antigen.

    ID: 1162753

    Description: epitope description:TASPGAASGPKVVIDGKDQN antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus C57BL/10

    Publication: 7516315;

  3. Identification of peptides mimicking the antigenicity and immunogenicity of conformational epitopes on Japanese encephalitis virus protein using synth...

    ID: 1162771

    Description: epitope description:YGGIYMNG host organism:Mus musculus BALB/c

    Publication: 8882934;

  4. Epitope specificity and isoforms of the mycobacterial 19-kilodalton antigen.

    ID: 1162772

    Description: epitope description:DMANPMSPVNKSFEIEVTCS antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus C57BL/10

    Publication: 7516315;

  5. Epitope specificity and isoforms of the mycobacterial 19-kilodalton antigen.

    ID: 1178713

    Description: epitope description:GAAILVAGLSGCSSNKSTTG antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus C57BL/10

    Publication: 7516315;

  6. Identification of an immunodominant antigenic site involving the capsid protein VP3 of hepatitis A virus.

    ID: 1186263

    Description: epitope description:D315 antigen name:Genome polyprotein host organism:Mus musculus antibody name:K2-4F2

    Publication: 2460866;

  7. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186389

    Description: epitope description:ISLPSYYPDQKSLENYIAQT antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  8. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186392

    Description: epitope description:STPREAPYELNITSATYQSA antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  9. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186393

    Description: epitope description:NITSATYQSAIPPRGTQAVV antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  10. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186396

    Description: epitope description:HPTTTYKAFDWDQAYRKPIT antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  11. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186397

    Description: epitope description:WDQAYRKPITYDTLWQADTD antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  12. Human T-cell epitopes on the Mycobacterium tuberculosis secreted protein MPT64.

    ID: 1186405

    Description: epitope description:TQVLVPRSAIDSMLA antigen name:Immunogenic protein MPT64 host organism:Homo sapiens

    Publication: 8658056;

  13. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187142

    Description: epitope description:AADKPTLDIRMMNIEATNLAL antigen name:Genome polyprotein host organism:Mus musculus C3H

    Publication: 1832722;

  14. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187152

    Description: epitope description:GSTDSTSHGNYSTQIGANQAVRFTI antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1832722;

  15. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187171

    Description: epitope description:CKIPISSVASLNDMTPVGR antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 1832722;

  16. T-helper cell and associated antibody response to synthetic peptides of the E glycoprotein of Murray Valley encephalitis virus.

    ID: 1187176

    Description: epitope description:VTANPYVASSTANAKVLVEIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1832722;

  17. Identification of helper T cell epitopes of dengue virus E-protein.

    ID: 1187188

    Description: epitope description:KGMSYSMCTGKFK antigen name:Genome polyprotein host organism:Mus musculus DBA/1

    Publication: 7683752;

  18. Identification of helper T cell epitopes of dengue virus E-protein.

    ID: 1187198

    Description: epitope description:GQLKLNWFKKGSSIG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7683752;

  19. Immune response related to the molecular structure of a peptide from the cholera toxin B subunit.

    ID: 1193772

    Description: epitope description:VEVPGSQHIDSQKKAIERMKNTLRIA antigen name:Cholera enterotoxin subunit B host organism:Mus musculus C57BL/6

    Publication: 7504858;

  20. Immunological characterization of alpha antigen of Mycobacterium kansasii: B-cell epitope mapping.

    ID: 1197630

    Description: epitope description:ILSVYHPQQFIYAGSLSALMDPSQGMGPSLI host organism:Mus musculus BALB/c

    Publication: 9714413;

  21. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1198223

    Description: epitope description:MRCIGISNRDFVEGVSGGSWVDIVLEHGSC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  22. Lassa virus glycoproteins: antigenic and immunogenic properties of synthetic peptides to GP1.

    ID: 1209210

    Description: epitope description:SQRTRDIYISR antigen name:Pre-glycoprotein polyprotein GP complex host organism:Oryctolagus cuniculus

    Publication: 1701079;

  23. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209218

    Description: epitope description:EAKQPATLRKYCCKKNMEGKVVLPENLEYTIV host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  24. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209220

    Description: epitope description:SRCPTQGEPSLNEEQDKRFLCKHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7505071;

  25. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209221

    Description: epitope description:EPSLNEEQDKRFLCKHSMVDR antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7505071;

  26. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209223

    Description: epitope description:CKKNMEGKVVLPENLEYTIV antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  27. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209230

    Description: epitope description:SRCPTQGEPSLNEEQDKRFLCKHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7505071;

  28. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209232

    Description: epitope description:FLCKHSMVDRGWGNGCGLFGKGGIVTCAMFT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7505071;

  29. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209234

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7505071;

  30. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209257

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  31. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209266

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  32. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209282

    Description: epitope description:SRSTSLSVSLVLVGVVTLYLGVMV antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  33. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209284

    Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7505071;

  34. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1209285

    Description: epitope description:IYGAAFSGVSWTMKILIGVIITWIGMNS antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7505071;

  35. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212427

    Description: epitope description:G53, I55, K166, K217, A219 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:719.3

    Publication: 2446011;

  36. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212430

    Description: epitope description:G53, I55, K166, K217 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:PVK

    Publication: 2446011;

  37. Antigenic site II of the rabies virus glycoprotein: structure and role in viral virulence.

    ID: 1212439

    Description: epitope description:G59, S61, R203, K217 antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:PVE

    Publication: 2446011;

  38. Mapping of functional regions of Clostridium perfringens type A enterotoxin.

    ID: 1212441

    Description: epitope description:SLDAGQYVLVMKANSSYSGNYPYSILFQKF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1373406;

  39. Mapping of functional regions of Clostridium perfringens type A enterotoxin.

    ID: 1212452

    Description: epitope description:SLDAGQYVLVMKANSSYSGNYPYSILFQKF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c antibody name:3C9

    Publication: 1373406;

  40. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1212485

    Description: epitope description:MRCIGISNRDFVEGVSGGSWVDIVLEHGSC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  41. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1212498

    Description: epitope description:FKNPHAKKQDVVVLGSQEGAMHT antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  42. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus.

    ID: 1212502

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 7505071;

  43. Antipeptide monoclonal antibodies inhibit the binding of rabies virus glycoprotein and alpha-bungarotoxin to the nicotinic acetylcholine receptor.

    ID: 1212511

    Description: epitope description:DIFTNSRGKRASKG antigen name:Glycoprotein host organism:Mus musculus BALB/c antibody name:2PV 36.74

    Publication: 3062388;

  44. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212526

    Description: epitope description:AAIGLSMAGSSAMILAAYHPQ antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 7525483;

  45. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212533

    Description: epitope description:NDPTQQIPKLVANNTRLWVY antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 7525483;

  46. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212549

    Description: epitope description:RCPPRRRA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  47. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212554

    Description: epitope description:RRAGRCPP antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  48. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212556

    Description: epitope description:PRRRAGRC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  49. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212557

    Description: epitope description:PRRRAGRC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  50. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212569

    Description: epitope description:QTEKFVKE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  51. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212572

    Description: epitope description:EKFVKEQR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  52. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212576

    Description: epitope description:FVKEQREA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  53. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212579

    Description: epitope description:VKEQREAE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  54. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212588

    Description: epitope description:EAEGGSKV antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  55. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212591

    Description: epitope description:AEGGSKVP antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  56. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212593

    Description: epitope description:EGGSKVPE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  57. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212600

    Description: epitope description:KVPEDTLN antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  58. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19090

    Description: epitope description:GANWRQEMRSKVASVE antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  59. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19092

    Description: epitope description:GANWRQEMRSKVASVE antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  60. Neutralizing epitopes specific for influenza B virus Yamagata group strains are in the 'loop'.

    ID: 18414

    Description: epitope description:G138, R146 antigen name:Hemagglutinin host organism:Mus musculus antibody name:5H4

    Publication: 12655076;

  61. Neutralizing epitopes specific for influenza B virus Yamagata group strains are in the 'loop'.

    ID: 18418

    Description: epitope description:G138, T144, S145, R146 antigen name:Hemagglutinin host organism:Mus musculus antibody name:3A12

    Publication: 12655076;

  62. Characterisation of the syncytia formed by VHS salmonid rhabdovirus G gene transfected cells.

    ID: 18595

    Description: epitope description:SKDHEYPFFPEPSCIWMK antigen name:glycoprotein host organism:Mus musculus BALB/c antibody name:110

    Publication: 15135981;

  63. Structural differences among hemagglutinins of influenza A virus subtypes are reflected in their antigenic architecture: analysis of H9 escape mutants...

    ID: 18683

    Description: epitope description:S145, T147, K165, P170, T197, T206 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:G9-6

    Publication: 14671105;

  64. Combinatorial use of antibodies to secreted mycobacterial proteins in a host immune system-independent test for tuberculosis.

    ID: 18843

    Description: epitope description:SSDPAWERNDPT antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Gallus gallus antibody name:85BCPL...

    Publication: 11427548;

  65. Use of linear and multiple antigenic peptides in the immunodiagnosis of acute hepatitis A virus infection.

    ID: 18899

    Description: epitope description:TVSTEQNVPDPQVGI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10669766;

  66. Use of linear and multiple antigenic peptides in the immunodiagnosis of acute hepatitis A virus infection.

    ID: 18902

    Description: epitope description:FWRGDLVFDFQV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10669766;

  67. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18908

    Description: epitope description:MKVKNTIAATSFAAAGLAAL antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  68. Use of linear and multiple antigenic peptides in the immunodiagnosis of acute hepatitis A virus infection.

    ID: 18916

    Description: epitope description:FWRGDLVFDFQV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10669766;

  69. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18948

    Description: epitope description:LNPQVNLVDTLNSGQYTVFA antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  70. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18957

    Description: epitope description:PTNAAFSKLPASTIDELKTN antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  71. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18961

    Description: epitope description:ASTIDELKTNSSLLTSILTY antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  72. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18964

    Description: epitope description:SSLLTSILTYHVVAGQTSPA antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  73. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18976

    Description: epitope description:GASVTVTGQGNSLKVGNADV antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  74. T- and B-cell epitopes in the secreted Mycobacterium bovis antigen MPB70 in mice.

    ID: 18980

    Description: epitope description:NSLKVGNADVVCGGVSTANA antigen name:Immunogenic protein MPB70 host organism:Mus musculus C57BL/6 X DBA/2 antibody name:Serum

    Publication: 12588661;

  75. A functional epitope determinant on domain III of the Japanese encephalitis virus envelope protein interacted with neutralizing-antibody combining sit...

    ID: 18991

    Description: epitope description:S331, D332 antigen name:Genome polyprotein host organism:Mus musculus antibody name:E3.3

    Publication: 12551998;

  76. Plasticity within the antigen-combining site may manifest as molecular mimicry in the humoral immune response.

    ID: 19025

    Description: epitope description:DVFYPYPYASGS host organism:Mus musculus BALB/c antibody name:6G8, 2D10, 1H11, 2F11, 5F5, 5F7, 4C4

    Publication: 15585860;

  77. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19037

    Description: epitope description:GGQQQESSVSSQSDQA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  78. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19047

    Description: epitope description:STSSQLGADSSSAGGQ antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  79. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19048

    Description: epitope description:STSSQLGADSSSAGGQ antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  80. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19051

    Description: epitope description:STSSQLGADSSSAGGQ antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  81. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19055

    Description: epitope description:DSSSAGGQQQESSVSS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  82. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19059

    Description: epitope description:QQESSVSSQSGQASTS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  83. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19063

    Description: epitope description:QSGQASTSSQLGTDSS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  84. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19066

    Description: epitope description:QSGQASTSSQLGTDSS antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  85. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19082

    Description: epitope description:SSVSSQSGQASTSSQS antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  86. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19083

    Description: epitope description:QASTSSQSGANWRQEM antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  87. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19096

    Description: epitope description:RSKVASVEYILAARAL antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  88. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19100

    Description: epitope description:YILAARALISVGVYAA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  89. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19110

    Description: epitope description:QGEIAKSQGCAPLRVA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  90. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19123

    Description: epitope description:GLVRSHFHDSGLSLGS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  91. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19138

    Description: epitope description:GDKLGLQGLKIGEGYA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  92. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19142

    Description: epitope description:GDKLGLQGLKIGEGYA antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  93. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19149

    Description: epitope description:TYLAQAFADNVVVAAD antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  94. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19158

    Description: epitope description:VQSGGACSASLDSAIA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  95. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19163

    Description: epitope description:ASLDSAIANVETSWSL antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  96. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19165

    Description: epitope description:ASLDSAIANVETSWSL antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  97. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19171

    Description: epitope description:NVETSWSLHGGLVSKD antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  98. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19190

    Description: epitope description:DFMFGGVSYNDGNASA antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  99. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19193

    Description: epitope description:YNDGNASAARSVLETL antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  100. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19203

    Description: epitope description:AGHVDALGISYNQLDK antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston