Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489916

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;
  2. Immunogold electron microscopic localization of the 2 EF-hand calcium-binding pollen allergen Phl p 7 and its homologues in pollens of grasses, weeds ...

    ID: 1491179

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 18204277;
  3. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491186

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;
  4. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491193

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;
  5. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491214

    Description: epitope description:ASQASNVFQGVFLTNNMLQHDC antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

Displaying 5 of 1,510,353 results for " "