Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19206

    Description: epitope description:AGHVDALGISYNQLDK antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  2. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19214

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  3. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19215

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  4. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19217

    Description: epitope description:LDADTLYSVVSFSAGS antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  5. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19220

    Description: epitope description:VVSFSAGSAIDRGAVS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  6. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19221

    Description: epitope description:VVSFSAGSAIDRGAVS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  7. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19224

    Description: epitope description:AIDRGAVSDAADKFRV antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  8. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19229

    Description: epitope description:DAADKFRVMMFGGAPA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  9. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19239

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  10. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19240

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  11. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19241

    Description: epitope description:GQEKTAEPEHEAATPS antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  12. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19246

    Description: epitope description:EHEAATPSASSVPSTV antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus

    Publication: 15010223;

  13. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19247

    Description: epitope description:EHEAATPSASSVPSTV antigen name:Major surface protein 1a (MSP1A) host organism:Mus musculus BALB/c

    Publication: 15010223;

  14. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19255

    Description: epitope description:HGKVVDAVDRAKEAAK antigen name:Major surface protein 1a (MSP1A) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15010223;

  15. Mapping of B-cell epitopes in the N-terminal repeated peptides of Anaplasma marginale major surface protein 1a and characterization of the humoral imm...

    ID: 19259

    Description: epitope description:DRAKEAAKQAYAGVRK antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus Holstein

    Publication: 15010223;

  16. Chemical chaperones enhance superantigen and conventional antigen presentation by HLA-DM-deficient as well as HLA-DM-sufficient antigen-presenting cel...

    ID: 1032229

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Mus musculus C57BL/6

    Publication: 9759841;

  17. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032265

    Description: epitope description:VEQLTGHGSSVLEELVQLVKDKNIDISIKY antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  18. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032271

    Description: epitope description:DKNIDISIKYDPRKDSEVFANRVITDDIEL antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  19. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032281

    Description: epitope description:VKEFLESSPNTQWELRAFMAVMHFSLTADR antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  20. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032285

    Description: epitope description:VMHFSLTADRIDDDILKVIVDSMNHHGDAR antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  21. Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibod...

    ID: 1032289

    Description: epitope description:DRPVPY host organism:Mus musculus antibody name:SA-3

    Publication: 9122216;

  22. Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibod...

    ID: 1032290

    Description: epitope description:DRPVPY host organism:Mus musculus antibody name:SA-3

    Publication: 9122216;

  23. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032291

    Description: epitope description:DSMNHHGDARSKLREELAELTAELKIYSVI antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  24. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032293

    Description: epitope description:DSMNHHGDARSKLREELAELTAELKIYSVI antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  25. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032294

    Description: epitope description:DSMNHHGDARSKLREELAELTAELKIYSVI antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  26. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032307

    Description: epitope description:SVIQAEINKHLSSSGTINIHDKSINLMDKN antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  27. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032308

    Description: epitope description:DKSINLMDKNLYGYTDEEIFKASAEYKILE antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  28. Analysis of the Yersinia pestis V protein for the presence of linear antibody epitopes.

    ID: 1032345

    Description: epitope description:VKEFLESSPNTQWELRAFMA antigen name:Virulence-associated V antigen host organism:Mus musculus ND4 Swiss Webster

    Publication: 9453605;

  29. Identification of immunodominant, group-specific and subcomplex-specific, continuous epitopes in the core regions of Japanese encephalitis virus using...

    ID: 1032471

    Description: epitope description:TKKPGGPGKNRAINM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8725101;

  30. Use of bacterial expression cloning to define the amino acid sequences of antigenic determinants on the G2 glycoprotein of Rift Valley fever virus.

    ID: 1032505

    Description: epitope description:KGTMDSGQTKR antigen name:Rift Valley fever phlebovirus protein host organism:Mus musculus antibody name:I

    Publication: 2422392;

  31. Use of bacterial expression cloning to define the amino acid sequences of antigenic determinants on the G2 glycoprotein of Rift Valley fever virus.

    ID: 1032515

    Description: epitope description:DCNFCRQMTGASLKKGSYPL antigen name:Rift Valley fever phlebovirus protein host organism:Mus musculus antibody name:I

    Publication: 2422392;

  32. Use of bacterial expression cloning to define the amino acid sequences of antigenic determinants on the G2 glycoprotein of Rift Valley fever virus.

    ID: 1032516

    Description: epitope description:DCNFCRQMTGASLKKGSYPL antigen name:Rift Valley fever phlebovirus protein host organism:Mus musculus antibody name:I

    Publication: 2422392;

  33. Yellow fever virus envelope protein has two discrete type-specific neutralizing epitopes.

    ID: 1032546

    Description: epitope description:D155, T158 antigen name:Genome polyprotein host organism:Mus musculus antibody name:B39

    Publication: 9191929;

  34. Mapping of antigenic sites involved in neutralization on the capsid protein of feline calicivirus.

    ID: 1036146

    Description: epitope description:A448 antigen name:Capsid protein host organism:Mus musculus antibody name:4B1

    Publication: 9018050;

  35. Vinculin proteolysis unmasks an ActA homolog for actin-based Shigella motility.

    ID: 1036159

    Description: epitope description:FEFPPPPTDE antigen name:Actin assembly-inducing protein host organism:Oryctolagus cuniculus antibody name:FS-1

    Publication: 9298981;

  36. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1036555

    Description: epitope description:LIGVKGSS antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  37. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1036557

    Description: epitope description:GVKGSSIA antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  38. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1036574

    Description: epitope description:ITQGIVEF antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  39. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1040982

    Description: epitope description:PKLAAAVL antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  40. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1040984

    Description: epitope description:LAAAVLNL antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  41. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1040999

    Description: epitope description:PTLLGEAT antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  42. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1041000

    Description: epitope description:TLLGEATA antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  43. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1041010

    Description: epitope description:TSNKFADF antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  44. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1041011

    Description: epitope description:SNKFADFL antigen name:Major outer membrane porin host organism:Oryctolagus cuniculus

    Publication: 9276405;

  45. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1041027

    Description: epitope description:LNLTTWNPTLLG antigen name:Major outer membrane porin host organism:Bos taurus

    Publication: 9276405;

  46. Use of synthetic antigens improves detection by enzyme-linked immunosorbent assay of antibodies against abortigenic Chlamydia psittaci in ruminants.

    ID: 1041028

    Description: epitope description:ATALDTSNKFADFLQI antigen name:Major outer membrane porin host organism:Bos taurus

    Publication: 9276405;

  47. Identification of B- and T-cell epitopes within the MTP40 protein of Mycobacterium tuberculosis and their correlation with the disease course.

    ID: 1041055

    Description: epitope description:TTLGMHCGSFGSAPSNG antigen name:Other Mycobacterium tuberculosis protein host organism:Homo sapiens

    Publication: 1711013;

  48. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22230

    Description: epitope description:VTITEQNGA antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  49. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22233

    Description: epitope description:WSTPRFRPI antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  50. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22240

    Description: epitope description:EQNGAKLGI antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  51. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22243

    Description: epitope description:LGIGVATDY antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  52. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22246

    Description: epitope description:TDYIVPGIP antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  53. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22247

    Description: epitope description:YIVPGIPDG antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  54. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22259

    Description: epitope description:YAITNGTGN antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  55. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22260

    Description: epitope description:ITNGTGNDI antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  56. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22281

    Description: epitope description:KKISNTAFI antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  57. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22285

    Description: epitope description:ITTATLDGD antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  58. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22286

    Description: epitope description:TATLDGDNN antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  59. The capsid gene of feline calicivirus contains linear B-cell epitopes in both variable and conserved regions.

    ID: 22294

    Description: epitope description:TATGYDTAD antigen name:Capsid protein host organism:Felis catus

    Publication: 10482602;

  60. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 22351

    Description: epitope description:NRYVELKRGEGKGA antigen name:Mammalian cell entry protein (UniProt:O07414) host organism:Oryctolagus cuniculus

    Publication: 10564555;

  61. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 22357

    Description: epitope description:TTPKNPTKRRITPKDVI antigen name:Virulence factor host organism:Oryctolagus cuniculus

    Publication: 10564555;

  62. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 22358

    Description: epitope description:TDELNQQRDDITRAI antigen name:Possible Mce-family lipoprotein LprK (Mce-family lipoprotein Mce1E) host organism:Oryctolagus cunicul...

    Publication: 10564555;

  63. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 22359

    Description: epitope description:AKFSDTIGKRDEQIT antigen name:Mammalian cell entry protein (UniProt:O07415) host organism:Oryctolagus cuniculus

    Publication: 10564555;

  64. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme...

    ID: 22362

    Description: epitope description:TTPKNPTKRRITPKDVI antigen name:Virulence factor host organism:Oryctolagus cuniculus

    Publication: 10564555;

  65. Identification of protective epitopes on ebola virus glycoprotein at the single amino acid level by using recombinant vesicular stomatitis viruses.

    ID: 22539

    Description: epitope description:R134, F194, L199 antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:226/8.1

    Publication: 12502822;

  66. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22806

    Description: epitope description:SKLNESINKAMININKFLN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  67. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22817

    Description: epitope description:ASLKDALLKYIYDNRGTLI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  68. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22818

    Description: epitope description:ASLKDALLKYIYDNRGTLI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  69. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22822

    Description: epitope description:RGTLIGQVDRLKDKVNNTL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  70. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22834

    Description: epitope description:KYVDNQRLLSTFTEYIKNI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  71. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22840

    Description: epitope description:YIKNIINTSILNLRYESNH antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  72. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22843

    Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  73. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22844

    Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  74. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22856

    Description: epitope description:EVILKNAIVYNSMYENFST antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  75. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22865

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  76. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22866

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  77. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22867

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  78. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22871

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  79. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22874

    Description: epitope description:QRVVFKYSQMINISDYINR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  80. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22882

    Description: epitope description:RLNNSKIYINGRLIDQKPI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  81. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22894

    Description: epitope description:RYIWIKYFNLFDKELNEKE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  82. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22896

    Description: epitope description:RYIWIKYFNLFDKELNEKE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  83. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22898

    Description: epitope description:LNEKEIKDLYDNQSNSGIL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  84. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22901

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  85. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22904

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  86. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22912

    Description: epitope description:KYVDVNNVGIRGYMYLKGP antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  87. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22913

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens

    Publication: 15115181;

  88. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22916

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  89. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22930

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  90. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22931

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  91. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22932

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Gallus gallus

    Publication: 15115181;

  92. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22939

    Description: epitope description:QVVVMKSKNDQGITNKCKM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  93. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22946

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  94. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22947

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  95. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22950

    Description: epitope description:LVASNWYNRQIERSSRTLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Equus caballus

    Publication: 15115181;

  96. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22951

    Description: epitope description:LVASNWYNRQIERSSRTLG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  97. Mapping of the antibody-binding regions on the HN-domain (residues 449-859) of botulinum neurotoxin A with antitoxin antibodies from four host species...

    ID: 22955

    Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus

    Publication: 15115181;

  98. Epitope mapping of neutralizing TSST-1 specific antibodies induced by immunization with toxin or toxoids.

    ID: 22959

    Description: epitope description:STNDNIKDLLD antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12399195;

  99. Epitope mapping of neutralizing TSST-1 specific antibodies induced by immunization with toxin or toxoids.

    ID: 22961

    Description: epitope description:LLDWYSSGSDT antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12399195;

  100. Epitope mapping of neutralizing TSST-1 specific antibodies induced by immunization with toxin or toxoids.

    ID: 22981

    Description: epitope description:SDTFTNSEVLD antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12399195;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston