Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489869

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  2. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489870

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:E3

    Publication: 18480437;

  3. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489872

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  4. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489873

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  5. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1489877

    Description: epitope description:NMMRFTSQPPNN host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  6. Identification of a conserved linear B-cell epitope at the N-terminus of the E2 glycoprotein of Classical swine fever virus by phage-displayed random ...

    ID: 1489878

    Description: epitope description:FDGTNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:HQ06

    Publication: 18485511;

  7. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489882

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  8. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489883

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:B2

    Publication: 18480437;

  9. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489890

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:E3

    Publication: 18480437;

  10. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489891

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  11. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489892

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  12. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489895

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  13. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489896

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  14. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489897

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  15. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1489912

    Description: epitope description:NMMRFTELSTPS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  16. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489916

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  17. Immunogold electron microscopic localization of the 2 EF-hand calcium-binding pollen allergen Phl p 7 and its homologues in pollens of grasses, weeds ...

    ID: 1491179

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 18204277;

  18. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491186

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  19. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491193

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  20. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491214

    Description: epitope description:ASQASNVFQGVFLTNNMLQHDC antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  21. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491234

    Description: epitope description:YATARAGADILWDVGAKVSMKLWGL antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  22. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491237

    Description: epitope description:KKENAANVNGTVGADALLTLGYR antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  23. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491254

    Description: epitope description:QAAAAVPATKWKAEYCGYY antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  24. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491263

    Description: epitope description:GFGSSTMGGKGG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  25. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491268

    Description: epitope description:GGDLYTVTNSDD antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  26. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491275

    Description: epitope description:DPVNPAPGTLRY antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  27. Multi-epitope DNA vaccine linked to the A2/B subunit of cholera toxin protect mice against Toxoplasma gondii.

    ID: 1491292

    Description: epitope description:TCPDKKSTA antigen name:Major surface antigen host organism:Mus musculus BALB/c

    Publication: 18555564;

  28. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491297

    Description: epitope description:PMYIAGYKTFDG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  29. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491299

    Description: epitope description:AGYKTFDGRGAQ antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  30. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491328

    Description: epitope description:NGGPCVFIKRVS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  31. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491330

    Description: epitope description:CVFIKRVSNVII antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  32. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491331

    Description: epitope description:FIKRVSNVIIHG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  33. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491336

    Description: epitope description:HGLHLYGCSTSV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  34. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491339

    Description: epitope description:LYGCSTSVLGNV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  35. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491342

    Description: epitope description:SVLGNVLINESF antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  36. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491345

    Description: epitope description:LINESFGVEPVH antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  37. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491356

    Description: epitope description:EPVHPQDGDALT antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  38. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491361

    Description: epitope description:LTLRTATNIWID antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  39. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491376

    Description: epitope description:TGVTISNNLFFN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  40. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491378

    Description: epitope description:ISNNLFFNHHKV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  41. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491380

    Description: epitope description:LFFNHHKVMLLG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  42. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491382

    Description: epitope description:HHKVMLLGHDDA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  43. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491393

    Description: epitope description:YSDDKSMKVTVA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  44. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491394

    Description: epitope description:DDKSMKVTVAFN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  45. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491395

    Description: epitope description:KSMKVTVAFNQF antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  46. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491397

    Description: epitope description:VTVAFNQFGPNC antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  47. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491399

    Description: epitope description:FNQFGPNCGQRM antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  48. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491418

    Description: epitope description:ARYGLVHVANNN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  49. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491424

    Description: epitope description:YDPWTIYAIGGS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  50. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491425

    Description: epitope description:PWTIYAIGGSSN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston