Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491569

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  2. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491570

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Oryctolagus cuniculus

    Publication: 15100313;

  3. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491575

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  4. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491577

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  5. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491589

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston