Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491429

    Description: epitope description:GSSNPTILSEGN antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  2. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491434

    Description: epitope description:GNSFTAPNESYK antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  3. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491446

    Description: epitope description:SSCSNWVWQSTQ antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  4. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491451

    Description: epitope description:TQDVFYNGAYFV antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  5. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491452

    Description: epitope description:DVFYNGAYFVSS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  6. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491456

    Description: epitope description:FVSSGKYEGGNI antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  7. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491461

    Description: epitope description:NIYTKKEAFNVE antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  8. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491463

    Description: epitope description:KKEAFNVENGNA antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  9. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491466

    Description: epitope description:VENGNATPQLTK antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  10. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491471

    Description: epitope description:TKNAGVLTCSLS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  11. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491472

    Description: epitope description:NAGVLTCSLSKR antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  12. Structure-immunogenicity relationship of melittin, its transposed analogues, and D-melittin.

    ID: 1491488

    Description: epitope description:GIGAVLKVLTTGLPALISWIKRKRQQ antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 8027544;

  13. Identification of binding sites for neutralizing monoclonal antibodies on the 14-kDa fusion protein of orthopox viruses.

    ID: 1491541

    Description: epitope description:STKAAKKPEAKREAI antigen name:Protein A27 host organism:Mus musculus BALB/c antibody name:3F5

    Publication: 7513923;

  14. Candidate multi-peptide-vaccine against classical swine fever virus induced potent immunity with serological marker.

    ID: 1491553

    Description: epitope description:CKEDYRYAISSTNEIGLLGAGGLT antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 15882522;

  15. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491566

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  16. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491569

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  17. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491570

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Oryctolagus cuniculus

    Publication: 15100313;

  18. Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

    ID: 1491575

    Description: epitope description:ADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSA antigen name:Phl p 7 host organism:Homo sapiens

    Publication: 15100313;

  19. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491577

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  20. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491589

    Description: epitope description:CGAVIDDC host organism:Mus musculus antibody name:MoAb 9-2-L3,7,9

    Publication: 15049781;

  21. Selection and characterization of cyclic peptides that bind to a monoclonal antibody against meningococcal L3,7,9 lipopolysaccharides.

    ID: 1491607

    Description: epitope description:CGAVIDDC host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 15049781;

  22. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491630

    Description: epitope description:EMPKNYEKVSLNRKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  23. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491631

    Description: epitope description:DMPQSYIQNQEKYKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  24. Passive protection against lethal enterovirus 71 infection in newborn mice by neutralizing antibodies elicited by a synthetic peptide.

    ID: 1491641

    Description: epitope description:VSSHRLDTGEVPALQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17890123;

  25. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491646

    Description: epitope description:KVRAYTYGVVDMPQSYIQNQEKYKK antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 16517887;

  26. Analysis of the antibody response to an immunodominant epitope of the envelope glycoprotein of a lentivirus and its diagnostic potential.

    ID: 1491651

    Description: epitope description:KVRAYTYGVVEMPTSYMESQKRKKK antigen name:envelope polyprotein host organism:Capra hircus Saanen

    Publication: 16517887;

  27. Structure-immunogenicity relationship of melittin and its N-terminal truncated analogs.

    ID: 1491662

    Description: epitope description:TTGLPALISWIKRKRQQ antigen name:Api m 4 host organism:Mus musculus BALB/c

    Publication: 7681691;

  28. Bioinformatics and multiepitope DNA immunization to design rational snake antivenom.

    ID: 1491728

    Description: epitope description:TECRGIRSECDLPEYCTGQ antigen name:Group III snake venom metalloproteinase (UniProt:Q2UXQ2) host organism:Mus musculus BALB/c

    Publication: 16737347;

  29. Bioinformatics and multiepitope DNA immunization to design rational snake antivenom.

    ID: 1491735

    Description: epitope description:GTKCEDGKVC antigen name:Group III snake venom metalloproteinase (UniProt:Q2UXQ2) host organism:Mus musculus BALB/c

    Publication: 16737347;

  30. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491765

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  31. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491772

    Description: epitope description:PEHKKEENMLSHLYVSSKDKENISKEND antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Human sera

    Publication: 15295710;

  32. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491777

    Description: epitope description:YEKAKNAYQKANQAVLKAKEASSYD antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  33. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491780

    Description: epitope description:PEHKKEENMLSHLYVSSKDKENISKEND antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Hyperimmune sera

    Publication: 15295710;

  34. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491783

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Affinity purified se...

    Publication: 15295710;

  35. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.

    ID: 1491784

    Description: epitope description:MLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEEKN antigen name:Merozoite surface protein 3 host organism:Homo sapiens antibody name:Affin...

    Publication: 15295710;

  36. Use of bacteriophage T7 displayed peptides for determination of monoclonal antibody specificity and biosensor analysis of the binding reaction.

    ID: 1491833

    Description: epitope description:CSKPKNRTC host organism:Mus musculus BALB/c antibody name:F4

    Publication: 10075827;

  37. Immunological analysis of the protective responses to the chimeric synthetic peptide representing T- and B-cell epitopes from the fusion protein of me...

    ID: 1479671

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 8806185;

  38. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479728

    Description: epitope description:EAIPALTAVETGHTSQV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  39. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479730

    Description: epitope description:EAIPALTAVETGHTSQV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  40. Characterisation of a protective linear B cell epitope against feline parvoviruses.

    ID: 1479737

    Description: epitope description:DGAVQPDGGQPAVRNERA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11257360;

  41. Mapping antigenic sites of an immunodominant surface lipoprotein of Mycoplasma agalactiae, AvgC, with the use of synthetic peptides.

    ID: 1479746

    Description: epitope description:DKKDKEDK antigen name:Variable surface lipoprotein U (VpmaUprecursor) host organism:Ovis aries

    Publication: 11748179;

  42. Coimmunization with complementary glucosyltransferase peptides results in enhanced immunogenicity and protection against dental caries.

    ID: 1479754

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:UniProt:I6TY13 host organism:Rattus norvegicus

    Publication: 10768962;

  43. Epitope mapping of the Pseudomonas aeruginosa major outer membrane porin protein OprF.

    ID: 1479756

    Description: epitope description:NLADFMKQ antigen name:Outer membrane porin F host organism:Mus musculus antibody name:MA7-2

    Publication: 7806382;

  44. Epitope mapping of the Pseudomonas aeruginosa major outer membrane porin protein OprF.

    ID: 1479757

    Description: epitope description:TAEGRAIN antigen name:Outer membrane porin F host organism:Mus musculus antibody name:MA5-8

    Publication: 7806382;

  45. Papaya ringspot virus coat protein gene for antigen presentation in Escherichia coli.

    ID: 1479765

    Description: epitope description:VQPDGGQPAVRNERA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c

    Publication: 16466633;

  46. The reactivity of naturally sensitized human CD4 cells and IgG antibodies to synthetic peptides derived from the amino terminal sequences of a 3800 MW...

    ID: 1479773

    Description: epitope description:GAGAGAVDSILGGVATYGAAC host organism:Homo sapiens antibody name:human serum

    Publication: 1689692;

  47. Monoclonal antibody against species-specific epitope of Pseudomonas aeruginosa Hsp60 protein cross-reacts with Pseudomonas stutzeri and other Pseudomo...

    ID: 1479958

    Description: epitope description:QADIEARVLQ antigen name:60 kDa chaperonin host organism:Mus musculus antibody name:2528

    Publication: 9297831;

  48. Precise characterization of the epitope recognized by a monoclonal antibody against Escherichia coli RNA polymerase.

    ID: 1479963

    Description: epitope description:VDGSDP antigen name:DNA-directed RNA polymerase subunit beta' (UniProt:P0A8T7) host organism:Mus musculus antibody name:11D11

    Publication: 15785203;

  49. Streptococcus pneumoniae enolase is important for plasminogen binding despite low abundance of enolase protein on the bacterial cell surface.

    ID: 1479971

    Description: epitope description:DKSRYGGLG antigen name:Enolase host organism:Mus musculus BALB/c antibody name:245, C-6

    Publication: 16622048;

  50. Structural variation and immune recognition of the P1.2 subtype meningococcal antigen.

    ID: 1479974

    Description: epitope description:HFVQQTPKSQPTLV antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN16C13F4

    Publication: 16470851;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston