Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480368

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  2. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480373

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  3. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480375

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3A5.4

    Publication: 17329445;

  4. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480401

    Description: epitope description:YFYDNTVGLNGIPTL antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:DD1

    Publication: 11254559;

  5. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480402

    Description: epitope description:DFAGVYGKTLSDYWSKYYDKFKLLLKNYYI antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:BF8

    Publication: 11254559;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston