Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243604

    Description: epitope description:TTLPKGFYAEGSRGG antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  2. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243607

    Description: epitope description:SQASSRSSSRSRGNS antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  3. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243614

    Description: epitope description:GETALALLLLDRLNQ antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  4. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243631

    Description: epitope description:HWPQIAQFAPSASAF antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  5. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243633

    Description: epitope description:SASAFFGMSRIGMEV antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  6. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243637

    Description: epitope description:WLTYHGAIKLDDKDP antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  7. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243638

    Description: epitope description:GAIKLDDKDPQFKDN antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  8. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243649

    Description: epitope description:PTVTLLPAADMDDFS antigen name:Nucleoprotein host organism:Macaca cyclopis

    Publication: 16494977;

  9. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243658

    Description: epitope description:RSAPRITFGGPTDST antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  10. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243665

    Description: epitope description:LPNNTASWFTALTQH antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  11. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243668

    Description: epitope description:GKEELRFPRGQGVPI antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  12. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243670

    Description: epitope description:QGVPINTNSGPDDQI antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  13. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243676

    Description: epitope description:KMKELSPRWYFYYLG antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  14. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243681

    Description: epitope description:ANKEGIVWVATEGAL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  15. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243682

    Description: epitope description:IVWVATEGALNTPKD antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  16. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243693

    Description: epitope description:SQASSRSSSRSRGNS antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  17. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243695

    Description: epitope description:SRGNSRNSTPGSSRG antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  18. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243703

    Description: epitope description:LESKVSGKGQQQQGQ antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  19. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243705

    Description: epitope description:QQQGQTVTKKSAAEA antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  20. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243717

    Description: epitope description:HWPQIAQFAPSASAF antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  21. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243718

    Description: epitope description:AQFAPSASAFFGMSR antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  22. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243723

    Description: epitope description:WLTYHGAIKLDDKDP antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  23. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243724

    Description: epitope description:GAIKLDDKDPQFKDN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  24. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243725

    Description: epitope description:DDKDPQFKDNVILLN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  25. Immunological characterizations of the nucleocapsid protein based SARS vaccine candidates.

    ID: 1243733

    Description: epitope description:QPLPQRQKKQPTVTL antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16494977;

  26. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243790

    Description: epitope description:LMESELVIGAVIIRGHLRMAGHPLGRCDIK antigen name:Membrane protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16081901;

  27. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243854

    Description: epitope description:VIGFLFLAWIMLLQFAY antigen name:Membrane protein host organism:Homo sapiens

    Publication: 16081901;

  28. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243855

    Description: epitope description:VIGFLFLAWIMLLQFAY antigen name:Membrane protein host organism:Mus musculus BALB/c

    Publication: 16081901;

  29. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243862

    Description: epitope description:LWLLWPVTLACFVLAAVY antigen name:Membrane protein host organism:Mus musculus BALB/c

    Publication: 16081901;

  30. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243864

    Description: epitope description:LACFVLAAVYRINWV antigen name:Membrane protein host organism:Homo sapiens

    Publication: 16081901;

  31. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243867

    Description: epitope description:LAAVYRINWVTGGIAIAM antigen name:Membrane protein host organism:Homo sapiens

    Publication: 16081901;

  32. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243884

    Description: epitope description:LMESELVIGAVIIRGHLR antigen name:Membrane protein host organism:Mus musculus BALB/c

    Publication: 16081901;

  33. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243892

    Description: epitope description:PKEITVATSRTLSYYKL antigen name:Membrane protein host organism:Mus musculus BALB/c

    Publication: 16081901;

  34. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243895

    Description: epitope description:TSRTLSYYKLGASQRV antigen name:Membrane protein host organism:Homo sapiens

    Publication: 16081901;

  35. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243896

    Description: epitope description:YYKLGASQRVGTDSGFAA antigen name:Membrane protein host organism:Homo sapiens

    Publication: 16081901;

  36. Identification of immunodominant epitopes on the membrane protein of the severe acute respiratory syndrome-associated coronavirus.

    ID: 1243900

    Description: epitope description:GFAAYNRYRIGNYKL antigen name:Membrane protein host organism:Mus musculus BALB/c

    Publication: 16081901;

  37. Enhancement of the antibody response to flavivirus B-cell epitopes by using homologous or heterologous T-cell epitopes.

    ID: 1244049

    Description: epitope description:CKKNMEGKVVLPENLEYTIV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1374807;

  38. Induction of neutralizing antibodies by a tobacco chloroplast-derived vaccine based on a B cell epitope from canine parvovirus.

    ID: 1244074

    Description: epitope description:MSDGAVQPDGGQPAVRNERATG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 16140352;

  39. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244106

    Description: epitope description:FTTKVIGKDSRDFDISPKV antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  40. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244112

    Description: epitope description:FTTKVIGKDSRDFDISPKV antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  41. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244122

    Description: epitope description:TSQDGNNHQFT antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  42. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244127

    Description: epitope description:DFFVRSIGSKGGKL antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  43. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244129

    Description: epitope description:DFFVRSIGSKGGKL antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  44. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244183

    Description: epitope description:DFFVRSIGSKGGKL antigen name:F1 capsule antigen host organism:Mus musculus BALB/c

    Publication: 16476510;

  45. The 2beta2-2beta3 loop of anthrax protective antigen contains a dominant neutralizing epitope.

    ID: 1244205

    Description: epitope description:SFFD antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:5E1, 2A8

    Publication: 16460675;

  46. Identification and antigenic epitope mapping of immunodominant region amino residues 510 to 672 on the spike protein of the severe acute respiratory s...

    ID: 1244207

    Description: epitope description:FQQFGRDVSDFTDSVRDPKT antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 16101348;

  47. Identification and antigenic epitope mapping of immunodominant region amino residues 510 to 672 on the spike protein of the severe acute respiratory s...

    ID: 1244220

    Description: epitope description:STAIHADQLTPAWRIY antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 16101348;

  48. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244233

    Description: epitope description:ITIMDNGNIDTELLVGTLTLGGY antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  49. Inducing systemic and mucosal immune responses to B-T construct of F1 antigen of Yersinia pestis in microsphere delivery.

    ID: 1244234

    Description: epitope description:ITIMDNGNIDTELLVGTLTLGGY antigen name:F1 capsule antigen host organism:Mus musculus Outbred

    Publication: 16476510;

  50. Protection of mice from group A streptococcal infection by intranasal immunisation with a peptide vaccine that contains a conserved M protein B cell e...

    ID: 1244307

    Description: epitope description:ASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

    Publication: 12034109;

  51. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244352

    Description: epitope description:DVVRDLPSGFNTLKPI antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 16461566;

  52. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244353

    Description: epitope description:DVQAPNYTQHTSSMRG antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 16461566;

  53. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244355

    Description: epitope description:CTTFDDVQAPNYTQHTSS antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 16461566;

  54. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244356

    Description: epitope description:RDVSDFTDSVRDPKTSEI antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 16461566;

  55. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244359

    Description: epitope description:APRITFGGPTDSTDNNQN antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16461566;

  56. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244361

    Description: epitope description:PKQRRPQGLPNNTASWFT antigen name:Nucleoprotein host organism:Homo sapiens

    Publication: 16461566;

  57. Specific epitopes of the structural and hypothetical proteins elicit variable humoral responses in SARS patients.

    ID: 1244365

    Description: epitope description:AMDPIYDEPTTTTSVPL antigen name:Protein 3a host organism:Homo sapiens

    Publication: 16461566;

  58. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212612

    Description: epitope description:LNKVDAAV antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  59. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212617

    Description: epitope description:DAAVAEAE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  60. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212618

    Description: epitope description:AAVAEAEG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  61. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212634

    Description: epitope description:WRIGYFGH antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  62. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212649

    Description: epitope description:HQVGDGEA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  63. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212653

    Description: epitope description:VGDGEAGP antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  64. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212654

    Description: epitope description:GEAGPGVA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  65. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212655

    Description: epitope description:GEAGPGVA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  66. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212663

    Description: epitope description:PGVAGSGA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  67. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212666

    Description: epitope description:VAGSGASD antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  68. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212680

    Description: epitope description:DLRSSSGC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  69. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212672

    Description: epitope description:SGASDLRS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  70. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212673

    Description: epitope description:SGASDLRS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  71. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212674

    Description: epitope description:GASDLRSS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  72. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1212888

    Description: epitope description:HSCSVPYEVKFNPVGRELYTHPPEH antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:I-A, I-B, I-C, I-D, ...

    Publication: 2146802;

  73. Functional and structural mapping of Chlamydia trachomatis species-specific major outer membrane protein epitopes by use of neutralizing monoclonal an...

    ID: 1212889

    Description: epitope description:TTLNPTIA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:E4, L1-4, L1-24

    Publication: 1718870;

  74. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1212891

    Description: epitope description:RGAYVEMHLPGSEVDSSLVSLSGSS antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:I-A, I-B, I-C, I-D, ...

    Publication: 2146802;

  75. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1212894

    Description: epitope description:HDGYVRLQTSSQYGLDSSGDLKGRT antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:I-A, I-B, I-C, I-D, ...

    Publication: 2146802;

  76. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1212901

    Description: epitope description:ECGGTKISKTINKTKNFSQCTKKEQ antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:I-F, II and V

    Publication: 2146802;

  77. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212687

    Description: epitope description:SSSGCVTG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  78. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212688

    Description: epitope description:SSGCVTGH antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  79. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1212691

    Description: epitope description:CVTGHWRC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  80. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212701

    Description: epitope description:DIKVQFQSGGNNSPAVYLLD antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  81. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212702

    Description: epitope description:NNSPAVYLLDGLRAQDDYNG antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  82. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212703

    Description: epitope description:GLRAQDDYNGWDINTPAFEW antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  83. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212710

    Description: epitope description:ANRAVKPTGSAAIGLSMAGS antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  84. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212718

    Description: epitope description:NDPTQQIPKLVANNTRLWVY antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  85. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212720

    Description: epitope description:CGNGTPNELGGANIPAEFLE antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  86. T-cell determinants and antibody binding sites on the major mycobacterial secretory protein MPB59 of Mycobacterium bovis.

    ID: 1212721

    Description: epitope description:GANIPAEFLENFVRSSNLKF antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Oryctolagus cuniculus

    Publication: 7525483;

  87. A completely synthetic toxoid vaccine containing Escherichia coli heat-stable toxin and antigenic determinants of the heat-labile toxin B subunit.

    ID: 1212732

    Description: epitope description:AIERMKDTLRITYLTETKIDK antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus

    Publication: 2581899;

  88. A completely synthetic toxoid vaccine containing Escherichia coli heat-stable toxin and antigenic determinants of the heat-labile toxin B subunit.

    ID: 1212740

    Description: epitope description:PGSQHIDSQKKAIERMKDTLR antigen name:Heat-labile enterotoxin B chain host organism:Oryctolagus cuniculus

    Publication: 2581899;

  89. A completely synthetic toxoid vaccine containing Escherichia coli heat-stable toxin and antigenic determinants of the heat-labile toxin B subunit.

    ID: 1212757

    Description: epitope description:MVIITFKSGETFQVEVPGSQHIDSQK antigen name:Heat-labile enterotoxin B chain host organism:Rattus norvegicus

    Publication: 2581899;

  90. Crystal structure of an anticholera toxin peptide complex at 2.3 A.

    ID: 1212758

    Description: epitope description:VEVPGSQHIDSQKKA antigen name:Cholera enterotoxin subunit B host organism:Mus musculus BALB/c antibody name:TE33

    Publication: 7690406;

  91. Localization and immunological characterization of antigenic domains of the rabies virus internal N and NS proteins.

    ID: 1212815

    Description: epitope description:HFVGCYMGQVRSLNATVIAACAPHE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:816-1, 805-3

    Publication: 2445121;

  92. Epitopes of group A streptococcal M protein that evoke cross-protective local immune responses.

    ID: 1212838

    Description: epitope description:KGLRRDLDASREAKKQLEAEHQKLEEQ antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1370521;

  93. Epitopes of group A streptococcal M protein that evoke cross-protective local immune responses.

    ID: 1212839

    Description: epitope description:KGLRRDLDASREAKKQLEAEHQKLEEQ antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 1370521;

  94. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212941

    Description: epitope description:AASGPKVVIDGKDQNVTGSV antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  95. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212950

    Description: epitope description:VTGSVVCTTAAGNVNIAIGG antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  96. Chimeric influenza viruses incorporating epitopes of outer membrane protein F as a vaccine against pulmonary infection with Pseudomonas aeruginosa.

    ID: 1212966

    Description: epitope description:GRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus

    Publication: 9382753;

  97. Monoclonal antibodies against different epitopes on colonization factor antigen I of enterotoxin-producing Escherichia coli.

    ID: 1212972

    Description: epitope description:VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVM antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus B...

    Publication: 2460491;

  98. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212996

    Description: epitope description:DGNPPEVKSVGLGNVNGVTL antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  99. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1213002

    Description: epitope description:NGVTLGYTSGTGQGNASATK antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  100. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1213027

    Description: epitope description:ATGVDMANPMSPVNKSFEIE antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston