Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380697

    Description: epitope description:PFGDSYIIIGVE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  2. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380704

    Description: epitope description:IGQMFETTMR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  3. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380715

    Description: epitope description:KILIGVIITWIGM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  4. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380716

    Description: epitope description:KILIGVIITWIGM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  5. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380720

    Description: epitope description:SRSTSLSVSLVLVGVVTLYLGAMV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  6. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380725

    Description: epitope description:LDFELI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  7. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380730

    Description: epitope description:YSMCTG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  8. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380769

    Description: epitope description:ETHVTGG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  9. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380770

    Description: epitope description:THVTGGA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  10. Antibodies to synthetic peptides from the preS1 region of the hepatitis B virus (HBV) envelope (env) protein are virus-neutralizing and protective.

    ID: 1380773

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP + MYRI(G3) antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbi...

    Publication: 2476893;

  11. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380776

    Description: epitope description:GAAARTT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  12. Antibodies to synthetic peptides from the preS1 region of the hepatitis B virus (HBV) envelope (env) protein are virus-neutralizing and protective.

    ID: 1380777

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP + MYRI(G12) antigen name:Large envelope protein host organism:Pan troglodytes antibody name:C...

    Publication: 2476893;

  13. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380789

    Description: epitope description:GLTSLFT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  14. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380790

    Description: epitope description:LTSLFTP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  15. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380792

    Description: epitope description:SLFTPGP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  16. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380794

    Description: epitope description:LFTPGPS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  17. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380799

    Description: epitope description:PSQKIQL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  18. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380810

    Description: epitope description:KTKRNTN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  19. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380812

    Description: epitope description:KRNTNRR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  20. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380814

    Description: epitope description:NTNRRPQ antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston