Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Induction of neutralizing antibodies by synthetic peptides representing the C terminus of coxsackievirus A9 capsid protein VP1.

    ID: 1479983

    Description: epitope description:QSRRRGDMST antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9747735;

  2. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479986

    Description: epitope description:Q249 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:B69

    Publication: 8178574;

  3. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479987

    Description: epitope description:E321 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:57

    Publication: 8178574;

  4. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479989

    Description: epitope description:E311, Q320 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:179

    Publication: 8178574;

  5. Molecular basis of antigenic variation in infectious bursal disease virus.

    ID: 1479993

    Description: epitope description:E311, Q320 antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:179

    Publication: 8178574;

  6. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480016

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 2212993;

  7. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480017

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus SJL

    Publication: 2212993;

  8. Prediction and identification of a T cell epitope in the fusion protein of measles virus immunodominant in mice and humans.

    ID: 1480020

    Description: epitope description:LSEIKGVIVHRLEGV antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 2212993;

  9. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480034

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  10. Characterization of a monoclonal antibody recognizing a DAG-containing epitope conserved in aphid transmissible potyviruses: evidence that the DAG mot...

    ID: 1480038

    Description: epitope description:CSDTIDAGKD antibody name:6C2-2C7

    Publication: 9879757;

  11. Antiviral effect on MS-2 coliphage obtained with a synthetic antigen.

    ID: 1480053

    Description: epitope description:QGLLKDGNPIPSAIAANSGIY antigen name:Coat protein host organism:Oryctolagus cuniculus albino antibody name:anti-P3

    Publication: 63950;

  12. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480063

    Description: epitope description:CAVFVRSGQPVIGA antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  13. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480064

    Description: epitope description:VSKEEQYYDYEDAT antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  14. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480065

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  15. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480073

    Description: epitope description:KEGYLVDKNTGCKYECLKLGDNDYCLR antigen name:Beta-mammal toxin Cn2 host organism:Mus musculus CD1

    Publication: 8578804;

  16. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480081

    Description: epitope description:KQQGYKGAGGY antigen name:Beta-mammal toxin Cn2 host organism:Mus musculus CD1

    Publication: 8578804;

  17. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480086

    Description: epitope description:GEYGGVIKDGTPGGA antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  18. The use of synthetic peptides can be a misleading approach to generate vaccines against scorpion toxins.

    ID: 1480090

    Description: epitope description:KGYLVDKNTGCKY host organism:Mus musculus CD1

    Publication: 8578804;

  19. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480096

    Description: epitope description:LTGISICNPGSSLC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  20. Mapping of linear B-cell epitopes of the S2 subunit of pertussis toxin.

    ID: 1480097

    Description: epitope description:TRNTGQPATDHYYSNV antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus

    Publication: 2463969;

  21. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480098

    Description: epitope description:LPAYQDYTARAQVSE antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(21-35)

    Publication: 3919385;

  22. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480105

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(41-50)

    Publication: 3919385;

  23. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480106

    Description: epitope description:TEYYLNHGKWPEN antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(48-60)

    Publication: 3919385;

  24. Antibodies to peptides corresponding to a conserved sequence of gonococcal pilins block bacterial adhesion.

    ID: 1480117

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus antibody name:anti-(107-121)

    Publication: 3919385;

  25. Antibody to glucosyltransferase induced by synthetic peptides associated with catalytic regions of alpha-amylases.

    ID: 1480131

    Description: epitope description:VPSYSFIRAHDSEVQDLIA antigen name:UniProt:I6TY13 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 10225934;

  26. Identification of a human immunodominant B-cell epitope within the immunoglobulin A1 protease of Streptococcus pneumoniae.

    ID: 1480137

    Description: epitope description:IQPELPEAVVSDKGEPEVQPTLPEAVVTDKGETEVQPE antigen name:Immunoglobulin A1 protease host organism:Homo sapiens

    Publication: 18088426;

  27. Epitope mapping on N-terminal region of taenia solium paramyosin.

    ID: 1480154

    Description: epitope description:FRTAISGTPQFY host organism:Oryctolagus cuniculus

    Publication: 10880841;

  28. Peptide/antibody recognition: synthetic peptides derived from the E. coli tryptophan synthase beta 2 subunit interact with high affinity with an anti-...

    ID: 1480184

    Description: epitope description:HGRVGIYFGMK antigen name:Tryptophan synthase beta chain host organism:Mus musculus antibody name:164-2

    Publication: 2062325;

  29. Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conju...

    ID: 1480185

    Description: epitope description:TKDTNNNL + ACET(T1) antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:MN12H2

    Publication: 9294871;

  30. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480234

    Description: epitope description:TRLENLMWK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 17329445;

  31. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480246

    Description: epitope description:VVSWKNKEL antigen name:Genome polyprotein host organism:Mus musculus Outbred

    Publication: 17329445;

  32. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480259

    Description: epitope description:LENLMWKQI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17329445;

  33. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480262

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  34. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480266

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A12.3, 3D1.4, 4H3.4, 3A5.4, ...

    Publication: 17329445;

  35. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480267

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  36. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480305

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus antibody name:anti-AFLX1

    Publication: 17329445;

  37. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480306

    Description: epitope description:ELRYSWKTWGKAKMLSTELH antigen name:Genome polyprotein host organism:Mus musculus antibody name:anti-D-2V NS1

    Publication: 17329445;

  38. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480336

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 17329445;

  39. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480341

    Description: epitope description:GKAKMLSTE antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 17329445;

  40. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480361

    Description: epitope description:YSWKTWGKA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1A12.3

    Publication: 17329445;

  41. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480368

    Description: epitope description:TELRYSWKT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3

    Publication: 17329445;

  42. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480373

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4

    Publication: 17329445;

  43. Antibody responses are generated to immunodominant ELK/KLE-type motifs on the nonstructural-1 glycoprotein during live dengue virus infections in mice...

    ID: 1480375

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3A5.4

    Publication: 17329445;

  44. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480401

    Description: epitope description:YFYDNTVGLNGIPTL antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:DD1

    Publication: 11254559;

  45. Epitope mapping of monoclonal antibodies capable of neutralizing cytotoxic necrotizing factor type 1 of uropathogenic Escherichia coli.

    ID: 1480402

    Description: epitope description:DFAGVYGKTLSDYWSKYYDKFKLLLKNYYI antigen name:Cytotoxic necrotizing factor 1 host organism:Mus musculus BALB/c antibody name:BF8

    Publication: 11254559;

  46. Conformational epitopes recognized by protective anti-neisserial surface protein A antibodies.

    ID: 1480409

    Description: epitope description:D113, L114, G115, G116, S117 antigen name:Outer membrane protein NspA host organism:Mus musculus CD1 antibody name:14C7, AL12

    Publication: 14638771;

  47. Immunoglobulin G antibodies binding to a synthetic peptide deduced from the nucleotide sequence of the env gene of HTLV I in patients with leukemia an...

    ID: 1480417

    Description: epitope description:TNSHVPILQERPPLE antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2999520;

  48. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487714

    Description: epitope description:QWIFGMS host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  49. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487716

    Description: epitope description:TASTLHKTLFGM host organism:Mus musculus BALB/c antibody name:BNTX 18

    Publication: 11750040;

  50. Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

    ID: 1487743

    Description: epitope description:DWERPTPYELSI host organism:Mus musculus BALB/c antibody name:BNTX21

    Publication: 11750040;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston