Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localization and immunological characterization of antigenic domains of the rabies virus internal N and NS proteins.

    ID: 1212815

    Description: epitope description:HFVGCYMGQVRSLNATVIAACAPHE antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:816-1, 805-3

    Publication: 2445121;

  2. Epitopes of group A streptococcal M protein that evoke cross-protective local immune responses.

    ID: 1212838

    Description: epitope description:KGLRRDLDASREAKKQLEAEHQKLEEQ antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1370521;

  3. Epitopes of group A streptococcal M protein that evoke cross-protective local immune responses.

    ID: 1212839

    Description: epitope description:KGLRRDLDASREAKKQLEAEHQKLEEQ antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 1370521;

  4. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212941

    Description: epitope description:AASGPKVVIDGKDQNVTGSV antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  5. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212950

    Description: epitope description:VTGSVVCTTAAGNVNIAIGG antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  6. Chimeric influenza viruses incorporating epitopes of outer membrane protein F as a vaccine against pulmonary infection with Pseudomonas aeruginosa.

    ID: 1212966

    Description: epitope description:GRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus

    Publication: 9382753;

  7. Monoclonal antibodies against different epitopes on colonization factor antigen I of enterotoxin-producing Escherichia coli.

    ID: 1212972

    Description: epitope description:VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVM antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4) host organism:Mus musculus B...

    Publication: 2460491;

  8. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1212996

    Description: epitope description:DGNPPEVKSVGLGNVNGVTL antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  9. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1213002

    Description: epitope description:NGVTLGYTSGTGQGNASATK antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;

  10. Mapping of T helper cell epitopes by using peptides spanning the 19-kDa protein of Mycobacterium tuberculosis. Evidence for unique and shared epitopes...

    ID: 1213027

    Description: epitope description:ATGVDMANPMSPVNKSFEIE antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 1372026;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston