Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246144

    Description: epitope description:K549 antigen name:Structural polyprotein host organism:Mus musculus antibody name:3E11

    Publication: 8973533;

  2. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246154

    Description: epitope description:S532, S533 antigen name:Structural polyprotein host organism:Mus musculus antibody name:2D4

    Publication: 8973533;

  3. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246342

    Description: epitope description:QVSIQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGK antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 2473217;

  4. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246395

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  5. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246396

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  6. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246411

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  7. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246413

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  8. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246415

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  9. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246426

    Description: epitope description:RTTTASGKLIT + NAc(R1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H5.4, 1G5.3

    Publication: 7944953;

  10. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246445

    Description: epitope description:LRYSWKTWGKA + NAc(L1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4, 1A12.3

    Publication: 7944953;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston