Phage-displayed Bet mim 1, a mimotope of the major birch pollen allergen Bet v 1, induces B cell responses to the natural antigen using bystander T ce...

ID: 1488213

Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c

Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antib...

ID: 1488238

Description: epitope description:TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN antigen name:Potassium channel toxin alpha-KTx 2.1 host organism:Mus musculus BALB/c antib...

Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

ID: 1488268

Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, FdR-1b, FdR-2b, C...

Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and de...

ID: 1488270

Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Mus musculus BALB/c antibody name:FdR-1a, C5/24.6

Binding of monoclonal antibody 4B1 to homologs of the lactose permease of Escherichia coli.

ID: 1488306

Description: epitope description:F247, F250, G254 antigen name:Lactose permease host organism:Mus musculus BALB/c antibody name:4B1