Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1225043

    Description: epitope description:STEELFKEYKLTRPYMARCIRCAVG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  2. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1225046

    Description: epitope description:RCAVGSCHSPIAIGAVKSDGHDGYV antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  3. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1225059

    Description: epitope description:LARCPAGDSITMGFLLDSVRHSCSV antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  4. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1225163

    Description: epitope description:TKKEQCRAYRLQNDKWVYNSDKLPK antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  5. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1237497

    Description: epitope description:STEELFKEYKLTRPYMARCIRCAVG antigen name:Structural polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2146802;

  6. Fine specificity and sequence of antibodies directed against the ectodomain of matrix protein 2 of influenza A virus.

    ID: 1242952

    Description: epitope description:LTEVETPIRNEWG antigen name:Matrix protein 2 host organism:Mus musculus BALB/c antibody name:14C2

    Publication: 16472860;

  7. Human anti-p68 autoantibodies recognize a common epitope of U1 RNA containing small nuclear ribonucleoprotein and influenza B virus.

    ID: 1243011

    Description: epitope description:PTRAETREERMERKRREKIE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 1689763;

  8. Human anti-p68 autoantibodies recognize a common epitope of U1 RNA containing small nuclear ribonucleoprotein and influenza B virus.

    ID: 1243038

    Description: epitope description:ERKRR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 1689763;

  9. Human anti-p68 autoantibodies recognize a common epitope of U1 RNA containing small nuclear ribonucleoprotein and influenza B virus.

    ID: 1243120

    Description: epitope description:ERKRR antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Homo sapiens

    Publication: 1689763;

  10. Priming immune response to cholera toxin induced by synthetic peptides.

    ID: 1243293

    Description: epitope description:LCAEYHNTQIHTL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3758153;

  11. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243295

    Description: epitope description:FNCLGMSSRDFIEGA antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  12. Priming immune response to cholera toxin induced by synthetic peptides.

    ID: 1243297

    Description: epitope description:VEVPGSQHIDSQKKA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3758153;

  13. Priming immune response to cholera toxin induced by synthetic peptides.

    ID: 1243300

    Description: epitope description:EKLCVWNNKTPHAIA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3758153;

  14. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243302

    Description: epitope description:FNCLGMSSRDFIEGA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  15. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243308

    Description: epitope description:TGESHNTKRADHNYLCKRGVT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  16. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243312

    Description: epitope description:TGESHNTKRADHNYLCKRGVT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  17. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243313

    Description: epitope description:SNSAAGRLILPEDIKYEVGV antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  18. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243314

    Description: epitope description:SNSAAGRLILPEDIKYEVGV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  19. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243329

    Description: epitope description:STEWRNREILVEFEEPHATKQS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  20. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243330

    Description: epitope description:CTEKFTFSKNPADTG antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  21. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243331

    Description: epitope description:CTEKFTFSKNPADTG antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  22. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243337

    Description: epitope description:EGASGATWVDLVLEGDSCITI antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2472704;

  23. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243338

    Description: epitope description:RVKMEKLKLKGTTYGMC antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  24. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243344

    Description: epitope description:VTANPYVASSTANAKVLVEIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  25. Synthetic peptides derived from the deduced amino acid sequence of the E-glycoprotein of Murray Valley encephalitis virus elicit antiviral antibody.

    ID: 1243350

    Description: epitope description:VTANPYVASSTANAKVLVEIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2472704;

  26. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1243364

    Description: epitope description:STEELFKEYKLTRPYMARCIRCAVG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  27. Synthetic peptides of Venezuelan equine encephalomyelitis virus E2 glycoprotein. I. Immunogenic analysis and identification of a protective peptide.

    ID: 1243369

    Description: epitope description:QVSLYTSRPCHIVDGHGYFLLARCP antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2146802;

  28. Localization of four antigenic sites involved in Venezuelan equine encephalomyelitis virus protection.

    ID: 1244778

    Description: epitope description:G393 antigen name:Structural polyprotein host organism:Mus musculus antibody name:7D1

    Publication: 7529989;

  29. Localization of four antigenic sites involved in Venezuelan equine encephalomyelitis virus protection.

    ID: 1244779

    Description: epitope description:Q550 antigen name:Structural polyprotein host organism:Mus musculus antibody name:3E11

    Publication: 7529989;

  30. Localization of four antigenic sites involved in Venezuelan equine encephalomyelitis virus protection.

    ID: 1244781

    Description: epitope description:S514, S516 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5A12

    Publication: 7529989;

  31. The high-affinity binding of Clostridium botulinum type B neurotoxin to synaptotagmin II associated with gangliosides GT1b/GD1a.

    ID: 1245738

    Description: epitope description:RNQE antigen name:Synaptotagmin-2 host organism:Mus musculus BALB/c antibody name:8G2b

    Publication: 8557112;

  32. Location of, immunogenicity of and relationships between neutralization epitopes on the attachment protein (G) of Hendra virus.

    ID: 1245746

    Description: epitope description:IH antigen name:Glycoprotein G host organism:Mus musculus BALB/c antibody name:3A5D.2

    Publication: 16186240;

  33. Fine mapping of a peptide sequence containing an antigenic site conserved among arenaviruses.

    ID: 1244419

    Description: epitope description:CNYSKFWYLEHAK antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus antibody name:33.6, 83.6

    Publication: 2452517;

  34. B cells and antibodies in the pathogenesis of myelin injury in Semliki Forest Virus encephalomyelitis.

    ID: 1244427

    Description: epitope description:THYGSLPQKSQH antigen name:Myelin basic protein (UniProt:P04370) host organism:Mus musculus C57BL/6

    Publication: 10716880;

  35. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1244487

    Description: epitope description:EYHNTQ antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP1

    Publication: 1715029;

  36. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1244490

    Description: epitope description:NTQIHT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP1

    Publication: 1715029;

  37. Identifying the principal protective antigenic determinants of type A botulinum neurotoxin.

    ID: 1244599

    Description: epitope description:GITNKCKMNLQDNNGNDIGFIGFHQ antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9795391;

  38. Identifying the principal protective antigenic determinants of type A botulinum neurotoxin.

    ID: 1244604

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9795391;

  39. Antagonism of the intracellular action of botulinum neurotoxin type A with monoclonal antibodies that map to light-chain epitopes.

    ID: 1244622

    Description: epitope description:GQMQPVKAFKIHNKIWVIPERDTFTN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody na...

    Publication: 7508383;

  40. Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibod...

    ID: 1244624

    Description: epitope description:EPYPMSEANYVRPMP host organism:Mus musculus antibody name:SE155.4

    Publication: 9122216;

  41. Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibod...

    ID: 1244629

    Description: epitope description:MDWNMH host organism:Mus musculus antibody name:SYA/J6

    Publication: 9122216;

  42. Expression of the nucleoprotein of rabies virus in Escherichia coli and mapping of antigenic sites.

    ID: 1244630

    Description: epitope description:FFRDEKEL antigen name:Nucleoprotein host organism:Mus musculus antibody name:6-4, 13-27, 12-2

    Publication: 7611878;

  43. Identifying the principal protective antigenic determinants of type A botulinum neurotoxin.

    ID: 1244634

    Description: epitope description:GTKFIIKKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody nam...

    Publication: 9795391;

  44. Toward a better understanding of the basis of the molecular mimicry of polysaccharide antigens by peptides: the example of Shigella flexneri 5a.

    ID: 1244652

    Description: epitope description:beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-[alpha-D-Glcp-(1->3)]-alpha-L-Rhap-(1->3)-alpha-L-Rhap antigen name:lipopolysaccharide h...

    Publication: 16251186;

  45. Toward a better understanding of the basis of the molecular mimicry of polysaccharide antigens by peptides: the example of Shigella flexneri 5a.

    ID: 1244666

    Description: epitope description:KRHFLSQRQ host organism:Mus musculus antibody name:C5, I3

    Publication: 16251186;

  46. Mapping of B epitopes in GRA4, a dense granule antigen of Toxoplasma gondii and protection studies using recombinant proteins administered by the oral...

    ID: 1244675

    Description: epitope description:KGFGGTRTSTAPAEAGKTELDDGYRPPPFNPRPSPYAELLKDLERMRKE antigen name:Other Toxoplasma gondii protein host organism:Homo sapiens

    Publication: 9618729;

  47. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1245767

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe...

    Publication: 16098493;

  48. Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

    ID: 1245831

    Description: epitope description:SPRWYFYYLGTGPEASLPYG antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

    Publication: 15759315;

  49. Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

    ID: 1245835

    Description: epitope description:NPNNNAATVLQLPQGTTLPK antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

    Publication: 15759315;

  50. Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

    ID: 1245840

    Description: epitope description:DRLNQLESKVSGKGQQQQGQ antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

    Publication: 15759315;

  51. Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

    ID: 1245843

    Description: epitope description:VTQAFGRRGPEQTQGNFGDQ antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

    Publication: 15759315;

  52. New methods using polyvinylidene difluoride membranes to detect enzymes involved in glycosphingolipid metabolism.

    ID: 1245881

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-Galp antigen name:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc host organism...

    Publication: 8678291;

  53. Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

    ID: 1245888

    Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Homo sapiens

    Publication: 11205105;

  54. Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

    ID: 1245900

    Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Mus musculus C57BL/6

    Publication: 11205105;

  55. Vaccination with the recombinant Brucella outer membrane protein 31 or a derived 27-amino-acid synthetic peptide elicits a CD4+ T helper 1 response th...

    ID: 1246085

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c

    Publication: 16299302;

  56. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246102

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe...

    Publication: 16098493;

  57. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246116

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

    Publication: 16098493;

  58. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246118

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

    Publication: 16098493;

  59. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246142

    Description: epitope description:G406, A440, D442 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5H6

    Publication: 8973533;

  60. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246143

    Description: epitope description:S514, S516 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5A12

    Publication: 8973533;

  61. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246144

    Description: epitope description:K549 antigen name:Structural polyprotein host organism:Mus musculus antibody name:3E11

    Publication: 8973533;

  62. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246154

    Description: epitope description:S532, S533 antigen name:Structural polyprotein host organism:Mus musculus antibody name:2D4

    Publication: 8973533;

  63. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246342

    Description: epitope description:QVSIQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGK antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 2473217;

  64. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246395

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  65. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246396

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  66. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246411

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  67. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246413

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  68. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246415

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  69. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246426

    Description: epitope description:RTTTASGKLIT + NAc(R1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H5.4, 1G5.3

    Publication: 7944953;

  70. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246445

    Description: epitope description:LRYSWKTWGKA + NAc(L1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4, 1A12.3

    Publication: 7944953;

  71. Use of recombinant fusion proteins and monoclonal antibodies to define linear and discontinuous antigenic sites on the dengue virus envelope glycoprot...

    ID: 1246594

    Description: epitope description:NKPTLDFELI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E2A10

    Publication: 1372140;

  72. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267403

    Description: epitope description:ATFQVE antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  73. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267404

    Description: epitope description:TFQVEV antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  74. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267405

    Description: epitope description:FQVEVP antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  75. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267408

    Description: epitope description:HIDSQK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  76. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267417

    Description: epitope description:TPQNIT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  77. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267431

    Description: epitope description:QIHTLN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  78. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267433

    Description: epitope description:HTLNNK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  79. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267437

    Description: epitope description:NKIFSY antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  80. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267446

    Description: epitope description:AGKREM antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  81. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267451

    Description: epitope description:MAIITF antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  82. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267453

    Description: epitope description:IITFKN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  83. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267460

    Description: epitope description:ATFQVE antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  84. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267463

    Description: epitope description:QVEVPG antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  85. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267469

    Description: epitope description:SQHIDS antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  86. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267470

    Description: epitope description:QHIDSQ antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  87. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267471

    Description: epitope description:IDSQKK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  88. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267473

    Description: epitope description:SQKKAI antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  89. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267475

    Description: epitope description:IERMKD antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  90. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267477

    Description: epitope description:KDTLRI antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  91. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267478

    Description: epitope description:DTLRIA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  92. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267481

    Description: epitope description:RIAYLT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  93. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267492

    Description: epitope description:KLCVWN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  94. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267494

    Description: epitope description:CVWNNK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  95. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267500

    Description: epitope description:TPHAIA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  96. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267506

    Description: epitope description:QNITDL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  97. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267507

    Description: epitope description:TQIHTL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  98. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267508

    Description: epitope description:FSYTES antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  99. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267509

    Description: epitope description:HIDSQK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  100. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267519

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5

    Publication: 1805311;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston