Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488475

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:Fab 5H2

    Publication: 17881450;

  2. Characterization of IgE-binding epitopes on Candida albicans enolase.

    ID: 1488480

    Description: epitope description:QAANDSYAAGWGVMVSHRSGETEDTFIADLSVGLRSGQI antigen name:Enolase 1 host organism:Homo sapiens

    Publication: 7544233;

  3. Epitope determinants of a chimpanzee dengue virus type 4 (DENV-4)-neutralizing antibody and protection against DENV-4 challenge in mice and rhesus mon...

    ID: 1488482

    Description: epitope description:K174, P176 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 17881450;

  4. Identification of an IgE-binding determinant of the major allergen Myr p I from the venom of the Australian jumper ant Myrmecia pilosula.

    ID: 1488608

    Description: epitope description:KEAIPMAVEMAKSQ antigen name:Myr p 1 host organism:Homo sapiens

    Publication: 7508264;

  5. Subgroup specific protection of mice from respiratory syncytial virus infection with peptides encompassing the amino acid region 174-187 from the G gl...

    ID: 1488614

    Description: epitope description:VPCSICSNNPTCWAICK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c

    Publication: 9141214;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston