Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267579

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  2. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267580

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  3. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267595

    Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  4. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267596

    Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  5. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267612

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  6. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267625

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  7. Serum antibodies against gangliosides and Campylobacter jejuni lipopolysaccharides in Miller Fisher syndrome.

    ID: 1267685

    Description: epitope description:alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp antigen name:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-ac...

    Publication: 9317004;

  8. Chimaeric HBV core particles carrying a defined segment of Puumala hantavirus nucleocapsid protein evoke protective immunity in an animal model.

    ID: 1267706

    Description: epitope description:MSDLTDIQEEITRHEQQLVVARQKLKDAERAVEVDPDDVNKSTLQ antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 9607042;

  9. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267746

    Description: epitope description:FSGVSWTM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  10. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267819

    Description: epitope description:PLPWLPGA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston