Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267821

    Description: epitope description:PLPWLPGA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  2. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267825

    Description: epitope description:DRGWGNGC antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  3. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267826

    Description: epitope description:DRGWGNGC antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  4. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267830

    Description: epitope description:NGCGLFGK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  5. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267832

    Description: epitope description:NGCGLFGK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  6. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267952

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5, BmE11-5

    Publication: 1805311;

  7. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267959

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5, BmE11-5

    Publication: 1805311;

  8. Chimaeric HBV core particles carrying a defined segment of Puumala hantavirus nucleocapsid protein evoke protective immunity in an animal model.

    ID: 1267963

    Description: epitope description:DVNKSTLQARQQTVSALEDKLADYKRRMADAVSRKKMDTKPTDPT antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 9607042;

  9. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267993

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5

    Publication: 1805311;

  10. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1267994

    Description: epitope description:QSYGPPKI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston