Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267550

    Description: epitope description:KNQIQLFNLESSKIEVILK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  2. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267551

    Description: epitope description:KNQIQLFNLESSKIEVILK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  3. Mapping of a region of dengue virus type-2 glycoprotein required for binding by a neutralizing monoclonal antibody.

    ID: 1246668

    Description: epitope description:QLKLNWFKKGSS antigen name:Genome polyprotein host organism:Mus musculus antibody name:3H5

    Publication: 1634111;

  4. Antigen chimaeras of poliovirus as potential new vaccines.

    ID: 1266827

    Description: epitope description:SASTKNKD antigen name:Genome polyprotein host organism:Mus musculus antibody name:955

    Publication: 2450279;

  5. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266909

    Description: epitope description:GGAATASAFSRPGLP antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  6. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266920

    Description: epitope description:YNGWDINTSAFEWYY antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  7. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266931

    Description: epitope description:SELPKWLSANRSVKS antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  8. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266939

    Description: epitope description:FIYAGSLSALMDSSQ antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  9. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266949

    Description: epitope description:PILQAGKLVANNTHL antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  10. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266957

    Description: epitope description:VHGSNLKFQDAYNGA antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  11. Identification of an antigenic domain on Mycobacterium leprae protein antigen 85B, which is specifically recognized by antibodies from patients with l...

    ID: 1266967

    Description: epitope description:GAQLNAMKPDLQNTL antigen name:UniProt:B8ZSL3 host organism:Homo sapiens

    Publication: 7506279;

  12. Induction of anti-carbohydrate antibodies by phage library-selected peptide mimics.

    ID: 1266998

    Description: epitope description:YKPLGALTH host organism:Mus musculus BALB/c antibody name:mIgA I3

    Publication: 9368618;

  13. Induction of anti-carbohydrate antibodies by phage library-selected peptide mimics.

    ID: 1267040

    Description: epitope description:KVPPWARTA host organism:Mus musculus BALB/c

    Publication: 9368618;

  14. Induction of anti-carbohydrate antibodies by phage library-selected peptide mimics.

    ID: 1267049

    Description: epitope description:KRHFLSQRQ host organism:Mus musculus BALB/c antibody name:mIgA C5

    Publication: 9368618;

  15. Induction of anti-carbohydrate antibodies by phage library-selected peptide mimics.

    ID: 1267059

    Description: epitope description:TRQQNNPER host organism:Mus musculus BALB/c antibody name:mIgA C5

    Publication: 9368618;

  16. Molecular recognition of a Salmonella trisaccharide epitope by monoclonal antibody Se155-4.

    ID: 1267185

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody ...

    Publication: 7513555;

  17. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267384

    Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  18. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267385

    Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  19. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267394

    Description: epitope description:SLAGKR antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP2

    Publication: 1715029;

  20. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267568

    Description: epitope description:FNSISLNNEYTIINCMENN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  21. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267579

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  22. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267580

    Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  23. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267595

    Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  24. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267596

    Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 9541456;

  25. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267612

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  26. Antibodies and T cells against synthetic peptides of the C-terminal domain (Hc) of botulinum neurotoxin type A and their cross-reaction with Hc.

    ID: 1267625

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 9541456;

  27. Serum antibodies against gangliosides and Campylobacter jejuni lipopolysaccharides in Miller Fisher syndrome.

    ID: 1267685

    Description: epitope description:alpha-Neup5Ac-(2->8)-alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-Glcp antigen name:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-ac...

    Publication: 9317004;

  28. Chimaeric HBV core particles carrying a defined segment of Puumala hantavirus nucleocapsid protein evoke protective immunity in an animal model.

    ID: 1267706

    Description: epitope description:MSDLTDIQEEITRHEQQLVVARQKLKDAERAVEVDPDDVNKSTLQ antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 9607042;

  29. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267746

    Description: epitope description:FSGVSWTM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  30. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267819

    Description: epitope description:PLPWLPGA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  31. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267821

    Description: epitope description:PLPWLPGA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  32. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267825

    Description: epitope description:DRGWGNGC antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  33. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267826

    Description: epitope description:DRGWGNGC antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  34. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267830

    Description: epitope description:NGCGLFGK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  35. Serologically defined linear epitopes in the envelope protein of dengue 2 (Jamaica strain 1409).

    ID: 1267832

    Description: epitope description:NGCGLFGK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2473720;

  36. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267952

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5, BmE11-5

    Publication: 1805311;

  37. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267959

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5, BmE11-5

    Publication: 1805311;

  38. Chimaeric HBV core particles carrying a defined segment of Puumala hantavirus nucleocapsid protein evoke protective immunity in an animal model.

    ID: 1267963

    Description: epitope description:DVNKSTLQARQQTVSALEDKLADYKRRMADAVSRKKMDTKPTDPT antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus

    Publication: 9607042;

  39. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267993

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5

    Publication: 1805311;

  40. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1267994

    Description: epitope description:QSYGPPKI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  41. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1268001

    Description: epitope description:ADVRKNSS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  42. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1268005

    Description: epitope description:KNSSPVKN antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  43. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1268007

    Description: epitope description:SSPVKNEE antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  44. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1268011

    Description: epitope description:VEDSKNFN antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  45. Epitope mapping of the Sta58 major outer membrane protein of Rickettsia tsutsugamushi.

    ID: 1268015

    Description: epitope description:EVEVVKGM antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7691753;

  46. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269040

    Description: epitope description:AKKTHSGI antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  47. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269041

    Description: epitope description:KKTHSGIS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  48. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269051

    Description: epitope description:GISDQKGA antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  49. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269053

    Description: epitope description:ISDQKGAL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  50. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269057

    Description: epitope description:DQKGALRK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  51. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269058

    Description: epitope description:DQKGALRK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  52. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269060

    Description: epitope description:QKGALRKN antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  53. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269063

    Description: epitope description:KGALRKNL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  54. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269074

    Description: epitope description:NLATAQSL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  55. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269079

    Description: epitope description:ATAQSLEK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  56. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269080

    Description: epitope description:TAQSLEKE antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  57. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269087

    Description: epitope description:SLEKELAG antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  58. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269091

    Description: epitope description:EKELAGSK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  59. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269093

    Description: epitope description:KELAGSKL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  60. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269097

    Description: epitope description:LAGSKLGL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  61. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269102

    Description: epitope description:SKLGLNKQ antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  62. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269107

    Description: epitope description:LGLNKQID antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  63. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269109

    Description: epitope description:GLNKQIDT antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  64. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269125

    Description: epitope description:NITSPQTN antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  65. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269136

    Description: epitope description:QTNSSTKF antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  66. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269144

    Description: epitope description:STKFLGKN antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  67. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269145

    Description: epitope description:TKFLGKNK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  68. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269146

    Description: epitope description:TKFLGKNK antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  69. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269151

    Description: epitope description:LGKNKLAP antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  70. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269156

    Description: epitope description:KNKLAPDN antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  71. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269158

    Description: epitope description:NKLAPDNI antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  72. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269162

    Description: epitope description:LAPDNISL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  73. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269188

    Description: epitope description:TSLSSPDI antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  74. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269206

    Description: epitope description:LQDKIDTQ antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  75. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269213

    Description: epitope description:IDTQRRTY antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  76. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269217

    Description: epitope description:TQRRTYEL antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  77. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269225

    Description: epitope description:TYELNTLS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  78. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269226

    Description: epitope description:TYELNTLS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  79. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269227

    Description: epitope description:YELNTLSA antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  80. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269244

    Description: epitope description:QQKQNIGR antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  81. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269245

    Description: epitope description:QKQNIGRA antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  82. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269250

    Description: epitope description:QNIGRATM antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  83. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269259

    Description: epitope description:ATMETSAV antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  84. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269265

    Description: epitope description:ETSAVAGN antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  85. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269269

    Description: epitope description:SAVAGNIS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  86. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269273

    Description: epitope description:VAGNISTS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  87. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269275

    Description: epitope description:AGNISTSG antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  88. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269276

    Description: epitope description:AGNISTSG antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  89. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269280

    Description: epitope description:NISTSGGR antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  90. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269285

    Description: epitope description:TSGGRYAS antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  91. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269292

    Description: epitope description:GRYASALE antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  92. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269295

    Description: epitope description:YASALEEE antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  93. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269298

    Description: epitope description:ASALEEEE antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  94. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269299

    Description: epitope description:SALEEEEQ antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  95. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269303

    Description: epitope description:LEEEEQLI antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  96. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269310

    Description: epitope description:EEQLISQA antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  97. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269318

    Description: epitope description:ISQASSKQ antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  98. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269319

    Description: epitope description:SQASSKQA antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  99. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269323

    Description: epitope description:ASSKQAEE antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;

  100. Recognition of three epitopic regions on invasion plasmid antigen C by immune sera of rhesus monkeys infected with Shigella flexneri 2a.

    ID: 1269329

    Description: epitope description:KQAEEASQ antigen name:Invasin IpaC host organism:Macaca mulatta

    Publication: 7558301;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston