Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

ID: 1381855

Description: epitope description:TFGGLLGEKT antigen name:Band 3 anion transport protein host organism:Homo sapiens

Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

ID: 1381858

Description: epitope description:LLGEKTRNQM antigen name:Band 3 anion transport protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379440

Description: epitope description:VLAVDAPN antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379442

Description: epitope description:TAGRFDSP antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379444

Description: epitope description:VWSILNRI antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379445

Description: epitope description:LNRIVRTL antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379446

Description: epitope description:VRTLLHGG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379456

Description: epitope description:HAFCHEEG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

Monoclonal antibodies targeting the HR2 domain and the region immediately upstream of the HR2 of the S protein neutralize in vitro infection of severe...

ID: 1379481

Description: epitope description:ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:1G10

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379488

Description: epitope description:GPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379498

Description: epitope description:GRPVA antigen name:HLA class II histocompatibility antigen, DRB1-7 beta chain host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379511

Description: epitope description:GRLDA antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379512

Description: epitope description:GPPAAGPPAAGPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379517

Description: epitope description:GPPAAEYWNSQ antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379526

Description: epitope description:TPLGPPAAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379530

Description: epitope description:GPPAAEYGPPAAEY host organism:Oryctolagus cuniculus New Zealand White

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379535

Description: epitope description:DNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Huma...

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379537

Description: epitope description:KNNQGNGQGHNMPNDPNRNVDENANANN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379538

Description: epitope description:NAVKNNNNEEPSDKHIEQYLKKIKNSISTEW antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379539

Description: epitope description:TPQGRPVAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens